BLASTX nr result
ID: Glycyrrhiza32_contig00025595
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00025595 (331 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010096977.1 hypothetical protein L484_024900 [Morus notabilis... 56 2e-07 XP_010108906.1 hypothetical protein L484_027101 [Morus notabilis... 53 7e-07 XP_010105590.1 hypothetical protein L484_011909 [Morus notabilis... 55 2e-06 >XP_010096977.1 hypothetical protein L484_024900 [Morus notabilis] EXB66604.1 hypothetical protein L484_024900 [Morus notabilis] Length = 147 Score = 55.8 bits (133), Expect = 2e-07 Identities = 22/45 (48%), Positives = 31/45 (68%) Frame = +2 Query: 197 NHPFSDSIMSAPLPNGFQHPKIQQYDGSSHPDDRLAMFNAHMLLY 331 +HPF++ IM+ PLP+ ++ P I YDG PDD L M+ HMLL+ Sbjct: 40 DHPFTEEIMAPPLPDKYRSPSIPPYDGRGDPDDHLEMYTGHMLLH 84 >XP_010108906.1 hypothetical protein L484_027101 [Morus notabilis] EXC20546.1 hypothetical protein L484_027101 [Morus notabilis] Length = 102 Score = 53.1 bits (126), Expect = 7e-07 Identities = 20/45 (44%), Positives = 33/45 (73%) Frame = +2 Query: 197 NHPFSDSIMSAPLPNGFQHPKIQQYDGSSHPDDRLAMFNAHMLLY 331 +HPF+++I+ PLP+ ++ P I YDG S+PDD L ++ HM+L+ Sbjct: 37 DHPFTENIIRVPLPDKYKSPPIPLYDGRSNPDDHLEVYTGHMVLH 81 >XP_010105590.1 hypothetical protein L484_011909 [Morus notabilis] EXC05119.1 hypothetical protein L484_011909 [Morus notabilis] Length = 377 Score = 54.7 bits (130), Expect = 2e-06 Identities = 22/45 (48%), Positives = 30/45 (66%) Frame = +2 Query: 197 NHPFSDSIMSAPLPNGFQHPKIQQYDGSSHPDDRLAMFNAHMLLY 331 +HPF + IM+ PLP+ ++ P I YDG PDD L M+ HMLL+ Sbjct: 157 DHPFIEEIMAPPLPDKYRSPSIPPYDGRGDPDDHLEMYTGHMLLH 201