BLASTX nr result
ID: Glycyrrhiza32_contig00025590
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00025590 (242 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004508639.1 PREDICTED: cysteine-rich and transmembrane domain... 57 7e-09 KRH03196.1 hypothetical protein GLYMA_17G082900 [Glycine max] 55 4e-08 KHN18396.1 hypothetical protein glysoja_006809 [Glycine soja] 55 6e-08 XP_013458040.1 hypothetical protein MTR_4g112890 [Medicago trunc... 49 3e-06 XP_003609184.1 hypothetical protein MTR_4g112890 [Medicago trunc... 49 4e-06 XP_007155193.1 hypothetical protein PHAVU_003G181200g [Phaseolus... 49 6e-06 >XP_004508639.1 PREDICTED: cysteine-rich and transmembrane domain-containing protein A-like [Cicer arietinum] Length = 76 Score = 56.6 bits (135), Expect = 7e-09 Identities = 25/40 (62%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Frame = -2 Query: 241 DKSKDTVAGPYQVPSPAIAITHEAPPS-GETKFKGSGFWR 125 D SKD+ AGPY +P P +ITH+ PPS +TK KGSGFWR Sbjct: 21 DVSKDSAAGPYPIPPPPASITHKVPPSCTQTKLKGSGFWR 60 >KRH03196.1 hypothetical protein GLYMA_17G082900 [Glycine max] Length = 75 Score = 54.7 bits (130), Expect = 4e-08 Identities = 29/41 (70%), Positives = 31/41 (75%), Gaps = 3/41 (7%) Frame = -2 Query: 238 KSKDTVAGP-YQVPSPAIAITHE--APPSGETKFKGSGFWR 125 +SKD GP YQVP PAI ITHE PP+GETKFKG GFWR Sbjct: 20 ESKDIAPGPNYQVPPPAI-ITHEEKVPPNGETKFKGDGFWR 59 >KHN18396.1 hypothetical protein glysoja_006809 [Glycine soja] Length = 96 Score = 54.7 bits (130), Expect = 6e-08 Identities = 29/41 (70%), Positives = 31/41 (75%), Gaps = 3/41 (7%) Frame = -2 Query: 238 KSKDTVAGP-YQVPSPAIAITHE--APPSGETKFKGSGFWR 125 +SKD GP YQVP PAI ITHE PP+GETKFKG GFWR Sbjct: 41 ESKDIAPGPNYQVPPPAI-ITHEEKVPPNGETKFKGDGFWR 80 >XP_013458040.1 hypothetical protein MTR_4g112890 [Medicago truncatula] KEH32071.1 hypothetical protein MTR_4g112890 [Medicago truncatula] Length = 54 Score = 49.3 bits (116), Expect = 3e-06 Identities = 23/42 (54%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = -2 Query: 241 DKSKDTVAGPYQVPSPAIA---ITHEAPPSGETKFKGSGFWR 125 D+SKDT GPY P PA + P + ETKFKGSGFWR Sbjct: 11 DQSKDTAVGPYLAPPPATVHKGYSQNVPQNRETKFKGSGFWR 52 >XP_003609184.1 hypothetical protein MTR_4g112890 [Medicago truncatula] AES91381.1 hypothetical protein MTR_4g112890 [Medicago truncatula] AFK34007.1 unknown [Medicago truncatula] Length = 68 Score = 49.3 bits (116), Expect = 4e-06 Identities = 23/42 (54%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = -2 Query: 241 DKSKDTVAGPYQVPSPAIA---ITHEAPPSGETKFKGSGFWR 125 D+SKDT GPY P PA + P + ETKFKGSGFWR Sbjct: 11 DQSKDTAVGPYLAPPPATVHKGYSQNVPQNRETKFKGSGFWR 52 >XP_007155193.1 hypothetical protein PHAVU_003G181200g [Phaseolus vulgaris] ESW27187.1 hypothetical protein PHAVU_003G181200g [Phaseolus vulgaris] Length = 70 Score = 48.9 bits (115), Expect = 6e-06 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = -2 Query: 241 DKSKDTVAGPYQVPSPAIAITHEAPPSGETKFKGSGFWR 125 D+SKDT GPY+VP P IT E ETKFKG GFWR Sbjct: 17 DESKDTAPGPYEVPPPPPVITLEDKVE-ETKFKGDGFWR 54