BLASTX nr result
ID: Glycyrrhiza32_contig00025387
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00025387 (250 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_074275340.1 hypothetical protein [Bradyrhizobium erythrophlei... 125 7e-36 SHH55288.1 Uncharacterized conserved protein, contains Zn-finger... 125 7e-36 SHH61639.1 Uncharacterized conserved protein, contains Zn-finger... 125 7e-36 WP_057860210.1 MULTISPECIES: hypothetical protein [Bradyrhizobiu... 125 7e-36 WP_057833775.1 hypothetical protein [Bradyrhizobium jicamae] KRR... 125 7e-36 WP_057852504.1 hypothetical protein [Bradyrhizobium valentinum] ... 125 7e-36 WP_044541387.1 MULTISPECIES: zinc-finger domain protein [Bradyrh... 125 7e-36 WP_029582063.1 hypothetical protein [Bradyrhizobium sp. URHD0069] 125 7e-36 WP_021077734.1 MULTISPECIES: hypothetical protein [Bradyrhizobiu... 125 7e-36 WP_018272338.1 MULTISPECIES: hypothetical protein [Bradyrhizobiu... 125 7e-36 SHL69762.1 Uncharacterized conserved protein, contains Zn-finger... 124 1e-35 WP_072822818.1 hypothetical protein [Bradyrhizobium erythrophlei... 124 2e-35 SDR92551.1 Uncharacterized conserved protein, contains Zn-finger... 123 3e-35 SEC42330.1 Uncharacterized conserved protein, contains Zn-finger... 123 4e-35 WP_074830849.1 hypothetical protein [Bradyrhizobium lablabi] SDJ... 123 4e-35 WP_063703045.1 MULTISPECIES: hypothetical protein [Bradyrhizobiu... 123 4e-35 WP_007602543.1 MULTISPECIES: hypothetical protein [Bradyrhizobiu... 123 4e-35 WP_038959577.1 hypothetical protein [Bradyrhizobium japonicum] 123 4e-35 WP_029081532.1 hypothetical protein [Bradyrhizobium sp. th.b2] 123 4e-35 WP_028342927.1 hypothetical protein [Bradyrhizobium elkanii] 123 4e-35 >WP_074275340.1 hypothetical protein [Bradyrhizobium erythrophlei] SIO46774.1 Uncharacterized conserved protein, contains Zn-finger domain [Bradyrhizobium erythrophlei] Length = 81 Score = 125 bits (313), Expect = 7e-36 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +1 Query: 85 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 249 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS Sbjct: 1 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 55 >SHH55288.1 Uncharacterized conserved protein, contains Zn-finger domain [Bradyrhizobium erythrophlei] Length = 81 Score = 125 bits (313), Expect = 7e-36 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +1 Query: 85 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 249 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS Sbjct: 1 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 55 >SHH61639.1 Uncharacterized conserved protein, contains Zn-finger domain [Bradyrhizobium erythrophlei] Length = 81 Score = 125 bits (313), Expect = 7e-36 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +1 Query: 85 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 249 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS Sbjct: 1 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 55 >WP_057860210.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] KRR21024.1 hypothetical protein CQ14_36080 [Bradyrhizobium lablabi] OCK57409.1 hypothetical protein LMTR21_15685 [Bradyrhizobium paxllaeri] Length = 81 Score = 125 bits (313), Expect = 7e-36 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +1 Query: 85 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 249 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS Sbjct: 1 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 55 >WP_057833775.1 hypothetical protein [Bradyrhizobium jicamae] KRR14812.1 hypothetical protein CQ12_29875 [Bradyrhizobium jicamae] Length = 81 Score = 125 bits (313), Expect = 7e-36 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +1 Query: 85 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 249 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS Sbjct: 1 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 55 >WP_057852504.1 hypothetical protein [Bradyrhizobium valentinum] KRR03869.1 hypothetical protein CQ10_17730 [Bradyrhizobium valentinum] KRR04096.1 hypothetical protein CP49_12920 [Bradyrhizobium valentinum] SDN19595.1 Uncharacterized conserved protein, contains Zn-finger domain [Afipia sp. GAS231] Length = 81 Score = 125 bits (313), Expect = 7e-36 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +1 Query: 85 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 249 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS Sbjct: 1 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 55 >WP_044541387.1 MULTISPECIES: zinc-finger domain protein [Bradyrhizobium] KJC38108.1 zinc-finger domain protein [Bradyrhizobium sp. LTSP885] KJC62609.1 zinc-finger domain protein [Bradyrhizobium sp. LTSPM299] Length = 81 Score = 125 bits (313), Expect = 7e-36 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +1 Query: 85 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 249 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS Sbjct: 1 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 55 >WP_029582063.1 hypothetical protein [Bradyrhizobium sp. URHD0069] Length = 81 Score = 125 bits (313), Expect = 7e-36 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +1 Query: 85 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 249 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS Sbjct: 1 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 55 >WP_021077734.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] ERF85983.1 hypothetical protein C207_00545 [Bradyrhizobium sp. DFCI-1] KIU43446.1 zinc-finger domain protein [Bradyrhizobium elkanii] OCX28677.1 hypothetical protein QU42_21735 [Bradyrhizobium sp. UASWS1016] OKO82110.1 zinc-finger domain protein [Bradyrhizobium sp. NAS96.2] Length = 81 Score = 125 bits (313), Expect = 7e-36 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +1 Query: 85 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 249 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS Sbjct: 1 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 55 >WP_018272338.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] KRP89559.1 hypothetical protein AOQ73_26200 [Bradyrhizobium pachyrhizi] ODM71752.1 hypothetical protein A6X20_07370 [Bradyrhizobium elkanii] ODM79126.1 hypothetical protein A6452_28955 [Bradyrhizobium elkanii] SDF44358.1 Uncharacterized conserved protein, contains Zn-finger domain [Bradyrhizobium sp. R5] OIM94428.1 hypothetical protein BLN97_10620 [Bradyrhizobium elkanii] OMI05692.1 hypothetical protein BSN85_24060 [Bradyrhizobium sp. UFLA 03-321] Length = 81 Score = 125 bits (313), Expect = 7e-36 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +1 Query: 85 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 249 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS Sbjct: 1 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 55 >SHL69762.1 Uncharacterized conserved protein, contains Zn-finger domain [Bradyrhizobium lablabi] Length = 81 Score = 124 bits (312), Expect = 1e-35 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = +1 Query: 85 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 249 MSDHVVPHFHNDAGVS+IEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS Sbjct: 1 MSDHVVPHFHNDAGVSIIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 55 >WP_072822818.1 hypothetical protein [Bradyrhizobium erythrophlei] SHN83697.1 Uncharacterized conserved protein, contains Zn-finger domain [Bradyrhizobium erythrophlei] Length = 81 Score = 124 bits (310), Expect = 2e-35 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = +1 Query: 85 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 249 MSDHVVPHFHNDAGV+VIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS Sbjct: 1 MSDHVVPHFHNDAGVAVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 55 >SDR92551.1 Uncharacterized conserved protein, contains Zn-finger domain [Bradyrhizobium canariense] Length = 81 Score = 123 bits (309), Expect = 3e-35 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = +1 Query: 85 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 249 MSDHVVPHFHNDAGVSVIEIGS+EFMCVGANPPFDHPHVFLDLGNDNEIICPYCS Sbjct: 1 MSDHVVPHFHNDAGVSVIEIGSKEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 55 >SEC42330.1 Uncharacterized conserved protein, contains Zn-finger domain [Bradyrhizobium erythrophlei] Length = 81 Score = 123 bits (308), Expect = 4e-35 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = +1 Query: 85 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 249 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGND+EIICPYCS Sbjct: 1 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDSEIICPYCS 55 >WP_074830849.1 hypothetical protein [Bradyrhizobium lablabi] SDJ88515.1 Uncharacterized conserved protein, contains Zn-finger domain [Bradyrhizobium ottawaense] SEC03049.1 Uncharacterized conserved protein, contains Zn-finger domain [Bradyrhizobium lablabi] SHM69359.1 Uncharacterized conserved protein, contains Zn-finger domain [Bradyrhizobium lablabi] Length = 81 Score = 123 bits (308), Expect = 4e-35 Identities = 54/55 (98%), Positives = 54/55 (98%) Frame = +1 Query: 85 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 249 MSDHVVPHFHNDAGV VIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS Sbjct: 1 MSDHVVPHFHNDAGVPVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 55 >WP_063703045.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] OAF06062.1 hypothetical protein AYJ54_20450 [Bradyrhizobium sp. BR 10245] OKO72154.1 zinc-finger domain protein [Bradyrhizobium sp. AS23.2] Length = 81 Score = 123 bits (308), Expect = 4e-35 Identities = 54/55 (98%), Positives = 54/55 (98%) Frame = +1 Query: 85 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 249 MSDHVVPHFHNDAGV VIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS Sbjct: 1 MSDHVVPHFHNDAGVPVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 55 >WP_007602543.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] NP_772230.1 hypothetical protein bsr5590 [Bradyrhizobium diazoefficiens USDA 110] BAC50855.1 bsr5590 [Bradyrhizobium diazoefficiens USDA 110] EHR04241.1 hypothetical protein Bra471DRAFT_05041 [Bradyrhizobium sp. WSM471] EIG62701.1 hypothetical protein Bra1253DRAFT_07632 [Bradyrhizobium sp. WSM1253] KGJ71172.1 hypothetical protein BJA5080_07942 [Bradyrhizobium diazoefficiens SEMIA 5080] KJC34845.1 zinc-finger domain protein [Bradyrhizobium sp. LTSP857] KJC53378.1 zinc-finger domain protein [Bradyrhizobium sp. LTSP849] BAR53527.1 hypothetical protein NK6_339 [Bradyrhizobium diazoefficiens] KOY09258.1 zinc-finger domain protein [Bradyrhizobium japonicum] KRQ17513.1 hypothetical protein AOQ71_01680 [Bradyrhizobium manausense] KYG20236.1 zinc-finger domain protein [Bradyrhizobium sp. AT1] AND90759.1 zinc-finger domain protein [Bradyrhizobium diazoefficiens USDA 110] CUT14981.1 FIG00450516 Zincfinger domain protein [Bradyrhizobium sp.] SCB54925.1 Uncharacterized conserved protein, contains Zn-finger domain [Bradyrhizobium sp. err11] SDI13336.1 Uncharacterized conserved protein, contains Zn-finger domain [Bradyrhizobium sp. Rc2d] SEN16466.1 Uncharacterized conserved protein, contains Zn-finger domain [Bradyrhizobium sp. OK095] SFO69933.1 Uncharacterized conserved protein, contains Zn-finger domain [Bradyrhizobium sp. Ghvi] SFN21301.1 Uncharacterized conserved protein, contains Zn-finger domain [Bradyrhizobium sp. Rc3b] SFJ88045.1 Uncharacterized conserved protein, contains Zn-finger domain [Bradyrhizobium sp. cf659] SFU66488.1 Uncharacterized conserved protein, contains Zn-finger domain [Bradyrhizobium arachidis] APG10967.1 hypothetical protein BKD09_RS21785 [Bradyrhizobium japonicum] APO52265.1 hypothetical protein BD122_18370 [Bradyrhizobium diazoefficiens] Length = 81 Score = 123 bits (308), Expect = 4e-35 Identities = 54/55 (98%), Positives = 54/55 (98%) Frame = +1 Query: 85 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 249 MSDHVVPHFHNDAGV VIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS Sbjct: 1 MSDHVVPHFHNDAGVPVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 55 >WP_038959577.1 hypothetical protein [Bradyrhizobium japonicum] Length = 81 Score = 123 bits (308), Expect = 4e-35 Identities = 54/55 (98%), Positives = 54/55 (98%) Frame = +1 Query: 85 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 249 MSDHVVPHFHNDAGV VIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS Sbjct: 1 MSDHVVPHFHNDAGVPVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 55 >WP_029081532.1 hypothetical protein [Bradyrhizobium sp. th.b2] Length = 81 Score = 123 bits (308), Expect = 4e-35 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = +1 Query: 85 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 249 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGND+EIICPYCS Sbjct: 1 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDSEIICPYCS 55 >WP_028342927.1 hypothetical protein [Bradyrhizobium elkanii] Length = 81 Score = 123 bits (308), Expect = 4e-35 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = +1 Query: 85 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDNEIICPYCS 249 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGND+EIICPYCS Sbjct: 1 MSDHVVPHFHNDAGVSVIEIGSQEFMCVGANPPFDHPHVFLDLGNDSEIICPYCS 55