BLASTX nr result
ID: Glycyrrhiza32_contig00025241
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00025241 (411 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007227228.1 hypothetical protein PRUPE_ppa018653mg [Prunus pe... 60 2e-08 >XP_007227228.1 hypothetical protein PRUPE_ppa018653mg [Prunus persica] Length = 191 Score = 60.1 bits (144), Expect = 2e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 248 MIKLAASFIYCSPVLKPICLDQDSIEVCLKSIT 150 MIK+ ASFIYCSPVLK IC DQD++EVCLKSIT Sbjct: 1 MIKMGASFIYCSPVLKLICFDQDTLEVCLKSIT 33