BLASTX nr result
ID: Glycyrrhiza32_contig00025173
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00025173 (640 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007155176.1 hypothetical protein PHAVU_003G179900g [Phaseolus... 53 3e-06 >XP_007155176.1 hypothetical protein PHAVU_003G179900g [Phaseolus vulgaris] ESW27170.1 hypothetical protein PHAVU_003G179900g [Phaseolus vulgaris] Length = 54 Score = 52.8 bits (125), Expect = 3e-06 Identities = 28/49 (57%), Positives = 33/49 (67%) Frame = -3 Query: 425 FLPPYGLKVSACFFLVTEKVSVECRVPSGRQHTVLYCI*VLVA*KSIKV 279 F P GLKVSACFF EKV +ECR PSGRQHT L+ + + V +KV Sbjct: 3 FSSPCGLKVSACFF--PEKVYLECRFPSGRQHTALHLVVLYVGLCCVKV 49