BLASTX nr result
ID: Glycyrrhiza32_contig00024846
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00024846 (327 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SEB82522.1 hypothetical protein SAMN05444164_0325 [Bradyrhizobiu... 85 6e-20 WP_016840752.1 hypothetical protein [Bradyrhizobium elkanii] ODM... 85 7e-20 WP_057019948.1 MULTISPECIES: hypothetical protein [Bradyrhizobiu... 85 9e-20 WP_050401388.1 hypothetical protein [Bradyrhizobium embrapense] 85 9e-20 WP_028332295.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] 85 9e-20 WP_029082211.1 hypothetical protein [Bradyrhizobium sp. th.b2] 85 1e-19 WP_044588339.1 hypothetical protein [Bradyrhizobium sp. LTSPM299... 84 2e-19 WP_074126738.1 hypothetical protein [Bradyrhizobium sp. NAS96.2]... 84 2e-19 WP_038383782.1 hypothetical protein [Bradyrhizobium elkanii] 84 2e-19 WP_050994058.1 hypothetical protein [Bradyrhizobium elkanii] 85 7e-19 ERF81473.1 phosphoglycolate phosphatase [Bradyrhizobium sp. DFCI-1] 82 1e-18 WP_076860240.1 hypothetical protein [Bradyrhizobium sp. SEMIA 6399] 82 1e-18 WP_024578501.1 MULTISPECIES: hypothetical protein [Bradyrhizobiu... 81 2e-18 WP_044541853.1 hypothetical protein [Bradyrhizobium sp. LTSP885] 81 3e-18 WP_050631882.1 hypothetical protein [Bradyrhizobium viridifuturi] 80 8e-18 WP_066507339.1 hypothetical protein [Bradyrhizobium sp. BR 10303... 75 9e-16 WP_018644656.1 hypothetical protein [Bradyrhizobium japonicum] 70 7e-14 SFU98947.1 hypothetical protein SAMN05192541_10922 [Bradyrhizobi... 70 8e-14 SFI53812.1 hypothetical protein SAMN05216525_11057 [Bradyrhizobi... 70 9e-14 SEM76299.1 hypothetical protein SAMN05443254_103601 [Bradyrhizob... 70 1e-13 >SEB82522.1 hypothetical protein SAMN05444164_0325 [Bradyrhizobium erythrophlei] Length = 55 Score = 85.1 bits (209), Expect = 6e-20 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 325 ESTFIIIAKAKVWVSEGWQVVITDKDGKSYPPEEFDKLLAA 203 ESTFIIIAKAKVW SEGWQVVITDKDGKSYPPEEFDKLLAA Sbjct: 15 ESTFIIIAKAKVWASEGWQVVITDKDGKSYPPEEFDKLLAA 55 >WP_016840752.1 hypothetical protein [Bradyrhizobium elkanii] ODM78042.1 hypothetical protein A6452_31995 [Bradyrhizobium elkanii] ODM78809.1 hypothetical protein A6X20_26750 [Bradyrhizobium elkanii] OIM90356.1 hypothetical protein BLN97_33675 [Bradyrhizobium elkanii] Length = 59 Score = 85.1 bits (209), Expect = 7e-20 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 325 ESTFIIIAKAKVWVSEGWQVVITDKDGKSYPPEEFDKLLAA 203 ESTFIIIAKAKVW SEGWQVVITDKDGKSYPPEEFDKLLAA Sbjct: 19 ESTFIIIAKAKVWASEGWQVVITDKDGKSYPPEEFDKLLAA 59 >WP_057019948.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] KRP87816.1 hypothetical protein AOQ73_31890 [Bradyrhizobium pachyrhizi] SDE52311.1 hypothetical protein SAMN05216337_102833 [Bradyrhizobium sp. R5] OMI03164.1 hypothetical protein BSN85_29730 [Bradyrhizobium sp. UFLA 03-321] Length = 68 Score = 85.1 bits (209), Expect = 9e-20 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 325 ESTFIIIAKAKVWVSEGWQVVITDKDGKSYPPEEFDKLLAA 203 ESTFIIIAKAKVW SEGWQVVITDKDGKSYPPEEFDKLLAA Sbjct: 28 ESTFIIIAKAKVWASEGWQVVITDKDGKSYPPEEFDKLLAA 68 >WP_050401388.1 hypothetical protein [Bradyrhizobium embrapense] Length = 68 Score = 85.1 bits (209), Expect = 9e-20 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 325 ESTFIIIAKAKVWVSEGWQVVITDKDGKSYPPEEFDKLLAA 203 ESTFIIIAKAKVW SEGWQVVITDKDGKSYPPEEFDKLLAA Sbjct: 28 ESTFIIIAKAKVWASEGWQVVITDKDGKSYPPEEFDKLLAA 68 >WP_028332295.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] Length = 68 Score = 85.1 bits (209), Expect = 9e-20 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 325 ESTFIIIAKAKVWVSEGWQVVITDKDGKSYPPEEFDKLLAA 203 ESTFIIIAKAKVW SEGWQVVITDKDGKSYPPEEFDKLLAA Sbjct: 28 ESTFIIIAKAKVWASEGWQVVITDKDGKSYPPEEFDKLLAA 68 >WP_029082211.1 hypothetical protein [Bradyrhizobium sp. th.b2] Length = 59 Score = 84.7 bits (208), Expect = 1e-19 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 325 ESTFIIIAKAKVWVSEGWQVVITDKDGKSYPPEEFDKLLAA 203 ESTFII+AKAKVW SEGWQVVITDKDGKSYPPEEFDKLLAA Sbjct: 19 ESTFIIVAKAKVWASEGWQVVITDKDGKSYPPEEFDKLLAA 59 >WP_044588339.1 hypothetical protein [Bradyrhizobium sp. LTSPM299] KJC59702.1 hypothetical protein UP10_16235 [Bradyrhizobium sp. LTSPM299] Length = 59 Score = 84.0 bits (206), Expect = 2e-19 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -3 Query: 325 ESTFIIIAKAKVWVSEGWQVVITDKDGKSYPPEEFDKLLAA 203 ESTF+I+AKAKVW SEGWQVVITDKDGKSYPPEEFDKLLAA Sbjct: 19 ESTFLIVAKAKVWASEGWQVVITDKDGKSYPPEEFDKLLAA 59 >WP_074126738.1 hypothetical protein [Bradyrhizobium sp. NAS96.2] OKO80138.1 hypothetical protein AC628_09905 [Bradyrhizobium sp. NAS96.2] Length = 68 Score = 84.0 bits (206), Expect = 2e-19 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 325 ESTFIIIAKAKVWVSEGWQVVITDKDGKSYPPEEFDKLLAA 203 ESTFIIIAKA+VW SEGWQVVITDKDGKSYPPEEFDKLLAA Sbjct: 28 ESTFIIIAKARVWASEGWQVVITDKDGKSYPPEEFDKLLAA 68 >WP_038383782.1 hypothetical protein [Bradyrhizobium elkanii] Length = 68 Score = 84.0 bits (206), Expect = 2e-19 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 325 ESTFIIIAKAKVWVSEGWQVVITDKDGKSYPPEEFDKLLAA 203 ESTFIIIAKA+VW SEGWQVVITDKDGKSYPPEEFDKLLAA Sbjct: 28 ESTFIIIAKARVWASEGWQVVITDKDGKSYPPEEFDKLLAA 68 >WP_050994058.1 hypothetical protein [Bradyrhizobium elkanii] Length = 149 Score = 85.1 bits (209), Expect = 7e-19 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -3 Query: 325 ESTFIIIAKAKVWVSEGWQVVITDKDGKSYPPEEFDKLLAA 203 ESTFIIIAKAKVW SEGWQVVITDKDGKSYPPEEFDKLLAA Sbjct: 109 ESTFIIIAKAKVWASEGWQVVITDKDGKSYPPEEFDKLLAA 149 >ERF81473.1 phosphoglycolate phosphatase [Bradyrhizobium sp. DFCI-1] Length = 68 Score = 82.4 bits (202), Expect = 1e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -3 Query: 325 ESTFIIIAKAKVWVSEGWQVVITDKDGKSYPPEEFDKLLAA 203 ES+FIIIAKA+VW SEGWQVVITDKDGKSYPPEEFDKLLAA Sbjct: 28 ESSFIIIAKARVWASEGWQVVITDKDGKSYPPEEFDKLLAA 68 >WP_076860240.1 hypothetical protein [Bradyrhizobium sp. SEMIA 6399] Length = 68 Score = 82.0 bits (201), Expect = 1e-18 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -3 Query: 325 ESTFIIIAKAKVWVSEGWQVVITDKDGKSYPPEEFDKLLAA 203 ESTFIIIAKA+VW SEGW VVITDKDGKSYPPEEFDKLLAA Sbjct: 28 ESTFIIIAKARVWASEGWHVVITDKDGKSYPPEEFDKLLAA 68 >WP_024578501.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] KIU46007.1 hypothetical protein QU41_24550 [Bradyrhizobium elkanii] OCX26957.1 hypothetical protein QU42_29885 [Bradyrhizobium sp. UASWS1016] Length = 59 Score = 81.3 bits (199), Expect = 2e-18 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -3 Query: 325 ESTFIIIAKAKVWVSEGWQVVITDKDGKSYPPEEFDKLLAA 203 ESTFIIIAKAKVW SEGWQVVITDKDGKSYP EEFDKLLAA Sbjct: 19 ESTFIIIAKAKVWASEGWQVVITDKDGKSYPLEEFDKLLAA 59 >WP_044541853.1 hypothetical protein [Bradyrhizobium sp. LTSP885] Length = 59 Score = 80.9 bits (198), Expect = 3e-18 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -3 Query: 325 ESTFIIIAKAKVWVSEGWQVVITDKDGKSYPPEEFDKLLAA 203 EST++I+AKA+VW SEGWQVVITDKDGKSYPPEEFDKLLAA Sbjct: 19 ESTWLIVAKARVWASEGWQVVITDKDGKSYPPEEFDKLLAA 59 >WP_050631882.1 hypothetical protein [Bradyrhizobium viridifuturi] Length = 68 Score = 80.1 bits (196), Expect = 8e-18 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -3 Query: 325 ESTFIIIAKAKVWVSEGWQVVITDKDGKSYPPEEFDKLLAA 203 ESTFIIIAKAKVW SEGWQVVITDKDGKSYP E+FDKLLAA Sbjct: 28 ESTFIIIAKAKVWASEGWQVVITDKDGKSYPLEDFDKLLAA 68 >WP_066507339.1 hypothetical protein [Bradyrhizobium sp. BR 10303] KWV55558.1 hypothetical protein AS156_05760 [Bradyrhizobium sp. BR 10303] Length = 59 Score = 74.7 bits (182), Expect = 9e-16 Identities = 32/41 (78%), Positives = 39/41 (95%) Frame = -3 Query: 325 ESTFIIIAKAKVWVSEGWQVVITDKDGKSYPPEEFDKLLAA 203 EST++I+AKA++W SEGW+VVITDKDGKSY P+EFDKLLAA Sbjct: 19 ESTWLIVAKARIWASEGWRVVITDKDGKSYAPDEFDKLLAA 59 >WP_018644656.1 hypothetical protein [Bradyrhizobium japonicum] Length = 68 Score = 70.1 bits (170), Expect = 7e-14 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -3 Query: 325 ESTFIIIAKAKVWVSEGWQVVITDKDGKSYPPEEFDKLLAA 203 ES +I+AKAKVW SEGWQVVITD+DGK+Y P EFD+LLAA Sbjct: 28 ESRLLIVAKAKVWASEGWQVVITDQDGKAYAPSEFDQLLAA 68 >SFU98947.1 hypothetical protein SAMN05192541_10922 [Bradyrhizobium arachidis] Length = 59 Score = 69.7 bits (169), Expect = 8e-14 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -3 Query: 325 ESTFIIIAKAKVWVSEGWQVVITDKDGKSYPPEEFDKLLAA 203 ES +I+AKA+VW SEGWQVVITD+DGKSY P EFD+LLAA Sbjct: 19 ESRLLIVAKARVWASEGWQVVITDQDGKSYTPPEFDQLLAA 59 >SFI53812.1 hypothetical protein SAMN05216525_11057 [Bradyrhizobium sp. Gha] Length = 61 Score = 69.7 bits (169), Expect = 9e-14 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -3 Query: 325 ESTFIIIAKAKVWVSEGWQVVITDKDGKSYPPEEFDKLLAA 203 ES +I+AKAKVW SEGW+VVITD+DGK+Y P EFDKLLAA Sbjct: 21 ESRLLIVAKAKVWASEGWRVVITDQDGKAYEPPEFDKLLAA 61 >SEM76299.1 hypothetical protein SAMN05443254_103601 [Bradyrhizobium sp. OK095] Length = 68 Score = 69.7 bits (169), Expect = 1e-13 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -3 Query: 325 ESTFIIIAKAKVWVSEGWQVVITDKDGKSYPPEEFDKLLAA 203 ES +I+AKAKVW SEGWQVVITD+DGK+Y P EFD+LLAA Sbjct: 28 ESRLLIVAKAKVWASEGWQVVITDQDGKAYTPPEFDQLLAA 68