BLASTX nr result
ID: Glycyrrhiza32_contig00024685
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00024685 (238 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_023808033.1 hypothetical protein [Mesorhizobium sp. L2C085B00... 79 2e-17 AID29013.1 hypothetical protein MCHK_1185 [Mesorhizobium huakuii... 59 1e-08 >WP_023808033.1 hypothetical protein [Mesorhizobium sp. L2C085B000] ESZ10582.1 hypothetical protein X735_28340 [Mesorhizobium sp. L2C085B000] Length = 94 Score = 78.6 bits (192), Expect = 2e-17 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -3 Query: 197 FSGFRLGDDDGVGGARTGYCDQGRSGAKEKALDVHFLTSSQ 75 FS FRLGDDDGVGGARTG CDQGRSGA+EKAL+VHFLTSSQ Sbjct: 49 FSRFRLGDDDGVGGARTGNCDQGRSGAEEKALNVHFLTSSQ 89 >AID29013.1 hypothetical protein MCHK_1185 [Mesorhizobium huakuii 7653R] Length = 184 Score = 58.5 bits (140), Expect = 1e-08 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -3 Query: 107 ALDVHFLTSSQKLKKRVWVFFAEGQRSLPHPHYRK 3 A+DV L K+KKRVWVFFAEGQRSLPHPHYRK Sbjct: 41 AVDVANLDVDIKVKKRVWVFFAEGQRSLPHPHYRK 75