BLASTX nr result
ID: Glycyrrhiza32_contig00024481
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00024481 (779 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EPS71012.1 hypothetical protein M569_03758, partial [Genlisea au... 62 3e-09 >EPS71012.1 hypothetical protein M569_03758, partial [Genlisea aurea] Length = 61 Score = 61.6 bits (148), Expect = 3e-09 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +1 Query: 634 VEMAWIMLSVDYSRLLWQLFGVFSYENHEWKPRIF 738 V + WIML +DYSRL W LFGVFSYENHE KPRIF Sbjct: 27 VGITWIMLRIDYSRLSWLLFGVFSYENHEGKPRIF 61