BLASTX nr result
ID: Glycyrrhiza32_contig00024101
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00024101 (247 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU31245.1 hypothetical protein TSUD_149310 [Trifolium subterran... 49 8e-06 >GAU31245.1 hypothetical protein TSUD_149310 [Trifolium subterraneum] Length = 98 Score = 49.3 bits (116), Expect = 8e-06 Identities = 21/37 (56%), Positives = 28/37 (75%) Frame = -3 Query: 233 HIYAAIIEEIWSFLRKSGESLCHTLREGNACADRLAK 123 H+YA +I++I + +S +LCHTLREGN CAD LAK Sbjct: 27 HVYAVLIQDIKELMSQSNITLCHTLREGNNCADFLAK 63