BLASTX nr result
ID: Glycyrrhiza32_contig00024100
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00024100 (241 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_024584638.1 MULTISPECIES: DNA-binding response regulator [Bra... 91 6e-21 WP_006022575.1 MULTISPECIES: DNA-binding response regulator [Rhi... 91 6e-21 OJY08847.1 DNA-binding response regulator [Rhizobiales bacterium... 81 3e-17 KIU49916.1 ATPase [Bradyrhizobium elkanii] 69 4e-12 WP_049707224.1 two-component sensor histidine kinase [Devosia sp... 69 4e-12 WP_006022574.1 MULTISPECIES: two-component sensor histidine kina... 69 4e-12 OJH79802.1 DNA-binding response regulator [Stenotrophomonas malt... 63 3e-10 WP_049464022.1 DNA-binding response regulator [Stenotrophomonas ... 63 3e-10 WP_025874434.1 DNA-binding response regulator [Stenotrophomonas ... 63 3e-10 WP_032974623.1 DNA-binding response regulator [Stenotrophomonas ... 63 3e-10 WP_033831197.1 DNA-binding response regulator [Stenotrophomonas ... 63 4e-10 SET29538.1 Two-component response regulator, FixJ family, consis... 61 1e-09 WP_059064287.1 DNA-binding response regulator [Stenotrophomonas ... 61 1e-09 WP_072168789.1 DNA-binding response regulator [Stenotrophomonas ... 61 1e-09 CCP11841.1 Nodulation protein W [Stenotrophomonas maltophilia SK... 61 2e-09 WP_049410901.1 DNA-binding response regulator [Stenotrophomonas ... 60 3e-09 WP_038692184.1 DNA-binding response regulator [Stenotrophomonas ... 60 4e-09 WP_070489584.1 DNA-binding response regulator [Stenotrophomonas ... 60 4e-09 WP_069138441.1 DNA-binding response regulator [Shinella fusca] 60 4e-09 WP_065186490.1 DNA-binding response regulator [Stenotrophomonas ... 60 4e-09 >WP_024584638.1 MULTISPECIES: DNA-binding response regulator [Bradyrhizobium] KIU49885.1 chemotaxis protein CheY [Bradyrhizobium elkanii] OCX32033.1 DNA-binding response regulator [Bradyrhizobium sp. UASWS1016] Length = 210 Score = 90.9 bits (224), Expect = 6e-21 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +3 Query: 102 MKNEPTADSRPQPIVYVIDDDRSVRAALEDLLASVGLQVRSYSSVA 239 MKNEPTADSRPQPIVYVIDDDRSVRAALEDLLASVGLQVRSYSSVA Sbjct: 1 MKNEPTADSRPQPIVYVIDDDRSVRAALEDLLASVGLQVRSYSSVA 46 >WP_006022575.1 MULTISPECIES: DNA-binding response regulator [Rhizobiales] EKS37445.1 sigma-70 family RNA polymerase sigma factor [Afipia broomeae ATCC 49717] CEG10299.1 Transcriptional regulatory protein FixJ [Afipia felis] AKR57851.1 chemotaxis protein CheY [Devosia sp. H5989] KQT28401.1 two-component system response regulator [Bradyrhizobium sp. Leaf396] Length = 210 Score = 90.9 bits (224), Expect = 6e-21 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +3 Query: 102 MKNEPTADSRPQPIVYVIDDDRSVRAALEDLLASVGLQVRSYSSVA 239 MKNEPTADSRPQPIVYVIDDDRSVRAALEDLLASVGLQVRSYSSVA Sbjct: 1 MKNEPTADSRPQPIVYVIDDDRSVRAALEDLLASVGLQVRSYSSVA 46 >OJY08847.1 DNA-binding response regulator [Rhizobiales bacterium 62-47] Length = 210 Score = 81.3 bits (199), Expect = 3e-17 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = +3 Query: 102 MKNEPTADSRPQPIVYVIDDDRSVRAALEDLLASVGLQVRSYSSVA 239 MKNEP + RPQPIVYVIDDDRSVRAALEDLLASVGLQVRS+SSVA Sbjct: 1 MKNEPIIEPRPQPIVYVIDDDRSVRAALEDLLASVGLQVRSHSSVA 46 >KIU49916.1 ATPase [Bradyrhizobium elkanii] Length = 351 Score = 69.3 bits (168), Expect = 4e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 TIVEANGGQISAAPVPGGGTVFEVRLPRHMEAA 99 TIVEANGGQISAAPVPGGGTVFEVRLPRHMEAA Sbjct: 319 TIVEANGGQISAAPVPGGGTVFEVRLPRHMEAA 351 >WP_049707224.1 two-component sensor histidine kinase [Devosia sp. H5989] AKR57852.1 ATPase [Devosia sp. H5989] Length = 354 Score = 69.3 bits (168), Expect = 4e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 TIVEANGGQISAAPVPGGGTVFEVRLPRHMEAA 99 TIVEANGGQISAAPVPGGGTVFEVRLPRHMEAA Sbjct: 322 TIVEANGGQISAAPVPGGGTVFEVRLPRHMEAA 354 >WP_006022574.1 MULTISPECIES: two-component sensor histidine kinase [Bradyrhizobiaceae] EKS37444.1 hypothetical protein HMPREF9695_03862 [Afipia broomeae ATCC 49717] CEG10300.1 Sensor protein FixL [Afipia felis] KQT28402.1 ATPase [Bradyrhizobium sp. Leaf396] OCX32034.1 two-component sensor histidine kinase [Bradyrhizobium sp. UASWS1016] Length = 354 Score = 69.3 bits (168), Expect = 4e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 1 TIVEANGGQISAAPVPGGGTVFEVRLPRHMEAA 99 TIVEANGGQISAAPVPGGGTVFEVRLPRHMEAA Sbjct: 322 TIVEANGGQISAAPVPGGGTVFEVRLPRHMEAA 354 >OJH79802.1 DNA-binding response regulator [Stenotrophomonas maltophilia] Length = 213 Score = 63.2 bits (152), Expect = 3e-10 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +3 Query: 102 MKNEPTADSRPQPIVYVIDDDRSVRAALEDLLASVGLQVRSYSS 233 M+ TA P PIVYVIDDD SVRAALEDLLAS+GLQVR+++S Sbjct: 1 MRKPTTAPMEPSPIVYVIDDDASVRAALEDLLASMGLQVRAFAS 44 >WP_049464022.1 DNA-binding response regulator [Stenotrophomonas maltophilia] Length = 213 Score = 63.2 bits (152), Expect = 3e-10 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +3 Query: 102 MKNEPTADSRPQPIVYVIDDDRSVRAALEDLLASVGLQVRSYSS 233 M+ TA P PIVYVIDDD SVRAALEDLLAS+GLQVR+++S Sbjct: 1 MRKPTTAPMEPSPIVYVIDDDASVRAALEDLLASMGLQVRAFAS 44 >WP_025874434.1 DNA-binding response regulator [Stenotrophomonas maltophilia] Length = 213 Score = 63.2 bits (152), Expect = 3e-10 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +3 Query: 102 MKNEPTADSRPQPIVYVIDDDRSVRAALEDLLASVGLQVRSYSS 233 M+ TA P PIVYVIDDD SVRAALEDLLAS+GLQVR+++S Sbjct: 1 MRKPTTAPMEPSPIVYVIDDDASVRAALEDLLASMGLQVRAFAS 44 >WP_032974623.1 DNA-binding response regulator [Stenotrophomonas sp. RIT309] EZP47713.1 Nodulation protein W [Stenotrophomonas sp. RIT309] Length = 213 Score = 63.2 bits (152), Expect = 3e-10 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +3 Query: 102 MKNEPTADSRPQPIVYVIDDDRSVRAALEDLLASVGLQVRSYSS 233 M+ TA P PIVYVIDDD SVRAALEDLLAS+GLQVR+++S Sbjct: 1 MRKATTAPMEPSPIVYVIDDDASVRAALEDLLASMGLQVRAFAS 44 >WP_033831197.1 DNA-binding response regulator [Stenotrophomonas maltophilia] EVT72632.1 chemotaxis protein CheY [Stenotrophomonas maltophilia 5BA-I-2] Length = 213 Score = 62.8 bits (151), Expect = 4e-10 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +3 Query: 102 MKNEPTADSRPQPIVYVIDDDRSVRAALEDLLASVGLQVRSYSS 233 M+ TA P PIVYVIDDD SVRAALEDLLAS+GLQVR+++S Sbjct: 1 MRKPTTAPMEPAPIVYVIDDDASVRAALEDLLASMGLQVRAFAS 44 >SET29538.1 Two-component response regulator, FixJ family, consists of REC and HTH domains [Stenotrophomonas sp. SC-N050] Length = 213 Score = 61.2 bits (147), Expect = 1e-09 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +3 Query: 102 MKNEPTADSRPQPIVYVIDDDRSVRAALEDLLASVGLQVRSYSS 233 M+ T P PIVYVIDDD SVRAALEDLLAS+GLQVR+++S Sbjct: 1 MRKPTTTPVEPSPIVYVIDDDASVRAALEDLLASMGLQVRAFAS 44 >WP_059064287.1 DNA-binding response regulator [Stenotrophomonas maltophilia] CRD51523.1 Nodulation protein W [Stenotrophomonas maltophilia] Length = 213 Score = 61.2 bits (147), Expect = 1e-09 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +3 Query: 102 MKNEPTADSRPQPIVYVIDDDRSVRAALEDLLASVGLQVRSYSS 233 M+ A P PIVYVIDDD SVRAALEDLLAS+GLQVR+++S Sbjct: 1 MRKPTAAPMEPSPIVYVIDDDASVRAALEDLLASMGLQVRAFAS 44 >WP_072168789.1 DNA-binding response regulator [Stenotrophomonas maltophilia] CRX69994.1 unnamed protein product [Stenotrophomonas maltophilia] Length = 213 Score = 61.2 bits (147), Expect = 1e-09 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +3 Query: 102 MKNEPTADSRPQPIVYVIDDDRSVRAALEDLLASVGLQVRSYSS 233 M+ + A+ P PIVYV+DDD SVRAALEDLLAS+GLQVR+++S Sbjct: 1 MRKQTAANPDPAPIVYVVDDDPSVRAALEDLLASMGLQVRAFAS 44 >CCP11841.1 Nodulation protein W [Stenotrophomonas maltophilia SKK35] Length = 216 Score = 60.8 bits (146), Expect = 2e-09 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = +3 Query: 96 SLMKNEPTADSRPQPIVYVIDDDRSVRAALEDLLASVGLQVRSYSS 233 SLM+ + P PIVYVIDDD SVRAALEDLLAS+GLQVR+++S Sbjct: 2 SLMRKPTAPVADPAPIVYVIDDDPSVRAALEDLLASMGLQVRAFAS 47 >WP_049410901.1 DNA-binding response regulator [Stenotrophomonas maltophilia] Length = 213 Score = 60.5 bits (145), Expect = 3e-09 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = +3 Query: 102 MKNEPTADSRPQPIVYVIDDDRSVRAALEDLLASVGLQVRSYSSV 236 M+ A P PIVYV+DDD SVRAALEDLLAS+GLQVR+++S+ Sbjct: 1 MRKPTAATPDPAPIVYVVDDDPSVRAALEDLLASMGLQVRAFASI 45 >WP_038692184.1 DNA-binding response regulator [Stenotrophomonas rhizophila] AHY58932.1 chemotaxis protein CheY [Stenotrophomonas rhizophila] Length = 211 Score = 60.1 bits (144), Expect = 4e-09 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +3 Query: 123 DSRPQPIVYVIDDDRSVRAALEDLLASVGLQVRSYSSVA 239 + P PIVYV+DDD SVRAALEDLLAS+G+QVR++ SVA Sbjct: 8 EGAPGPIVYVVDDDHSVRAALEDLLASMGMQVRAFDSVA 46 >WP_070489584.1 DNA-binding response regulator [Stenotrophomonas sp. HMSC10F07] OFU97045.1 DNA-binding response regulator [Stenotrophomonas sp. HMSC10F07] Length = 213 Score = 60.1 bits (144), Expect = 4e-09 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +3 Query: 102 MKNEPTADSRPQPIVYVIDDDRSVRAALEDLLASVGLQVRSYSS 233 M+ A+ P PIVYV+DDD SVRAALEDLLAS+GLQVR+++S Sbjct: 1 MRKPTAANPDPAPIVYVVDDDPSVRAALEDLLASMGLQVRAFAS 44 >WP_069138441.1 DNA-binding response regulator [Shinella fusca] Length = 213 Score = 60.1 bits (144), Expect = 4e-09 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +3 Query: 102 MKNEPTADSRPQPIVYVIDDDRSVRAALEDLLASVGLQVRSYSS 233 M+ A+ P PIVYV+DDD SVRAALEDLLAS+GLQVR+++S Sbjct: 1 MRKPTAANPDPAPIVYVVDDDPSVRAALEDLLASMGLQVRAFAS 44 >WP_065186490.1 DNA-binding response regulator [Stenotrophomonas maltophilia] OBU56203.1 DNA-binding response regulator [Stenotrophomonas maltophilia] Length = 213 Score = 60.1 bits (144), Expect = 4e-09 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +3 Query: 102 MKNEPTADSRPQPIVYVIDDDRSVRAALEDLLASVGLQVRSYSS 233 M+ A+ P PIVYV+DDD SVRAALEDLLAS+GLQVR+++S Sbjct: 1 MRKPTAANPDPAPIVYVVDDDPSVRAALEDLLASMGLQVRAFAS 44