BLASTX nr result
ID: Glycyrrhiza32_contig00023937
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00023937 (894 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP49110.1 hypothetical protein KK1_029141 [Cajanus cajan] 53 8e-06 >KYP49110.1 hypothetical protein KK1_029141 [Cajanus cajan] Length = 66 Score = 52.8 bits (125), Expect = 8e-06 Identities = 24/46 (52%), Positives = 32/46 (69%) Frame = +1 Query: 1 RTDTTLDLSQKAEKGMICLVTHCGFYTCYMPCCFVDNPMWDSHMAN 138 RTDTTLDLSQKAEKGM+C +T C FY+ + + +WD M++ Sbjct: 11 RTDTTLDLSQKAEKGMLCKLTRCFFYSQFHFAYSFSSAVWDLDMSS 56