BLASTX nr result
ID: Glycyrrhiza32_contig00023891
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00023891 (286 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIV89912.1 hypothetical protein TanjilG_08886 [Lupinus angustifo... 51 2e-06 >OIV89912.1 hypothetical protein TanjilG_08886 [Lupinus angustifolius] Length = 72 Score = 50.8 bits (120), Expect = 2e-06 Identities = 23/45 (51%), Positives = 30/45 (66%) Frame = -2 Query: 285 NCLLPETVQALICSRNWLHGFKEVGPSDVPEVEEIQLFAKQTIVD 151 +CLLP VQALICSRNWLHGF E G D ++ L ++ ++D Sbjct: 31 SCLLPNNVQALICSRNWLHGFAENGDDD---DDDSDLHSRSVVID 72