BLASTX nr result
ID: Glycyrrhiza32_contig00023796
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00023796 (389 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU47186.1 hypothetical protein TSUD_350510 [Trifolium subterran... 54 9e-12 KYP54665.1 Arginine/serine-rich-splicing factor RSP31 [Cajanus c... 61 2e-08 >GAU47186.1 hypothetical protein TSUD_350510 [Trifolium subterraneum] Length = 291 Score = 54.3 bits (129), Expect(2) = 9e-12 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +3 Query: 228 LLCNFFLEGNLPACLLSFYPQICIFS 305 L NFFLEGNLPACLLSFYPQICIFS Sbjct: 53 LSANFFLEGNLPACLLSFYPQICIFS 78 Score = 42.7 bits (99), Expect(2) = 9e-12 Identities = 22/29 (75%), Positives = 24/29 (82%) Frame = +1 Query: 160 VSFDAGTSTKGKYAELLSWLANLFSAIFF 246 V +GT+TKGKYAELLSWLANL SA FF Sbjct: 31 VDMKSGTTTKGKYAELLSWLANL-SANFF 58 >KYP54665.1 Arginine/serine-rich-splicing factor RSP31 [Cajanus cajan] Length = 354 Score = 61.2 bits (147), Expect = 2e-08 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = +1 Query: 238 IFFWKETFLLVCSPSIHRSAFSHLMLIRHPLPSSPNIDIFIPSEC 372 IFFWKETFLLVC PS +RSAFSHL +IRH L SS + +I I EC Sbjct: 55 IFFWKETFLLVCPPSTYRSAFSHL-IIRHSLTSSSSPNIDISPEC 98