BLASTX nr result
ID: Glycyrrhiza32_contig00023794
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00023794 (427 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KOM31535.1 hypothetical protein LR48_Vigan01g109000 [Vigna angul... 65 5e-10 XP_017440299.1 PREDICTED: guanylate-binding protein 1-like [Vign... 65 1e-09 XP_014493951.1 PREDICTED: guanylate-binding protein 1-like [Vign... 65 1e-09 XP_007156491.1 hypothetical protein PHAVU_003G290500g [Phaseolus... 65 1e-09 KYP76312.1 Interferon-induced guanylate-binding protein 2 [Cajan... 65 2e-09 XP_004505099.1 PREDICTED: interferon-induced guanylate-binding p... 65 2e-09 KHN15501.1 Interferon-induced guanylate-binding protein 1 [Glyci... 64 5e-09 GAU32474.1 hypothetical protein TSUD_64240 [Trifolium subterraneum] 63 7e-09 KRH50126.1 hypothetical protein GLYMA_07G202100 [Glycine max] 62 2e-08 XP_003529353.1 PREDICTED: guanylate-binding protein 1-like [Glyc... 62 2e-08 KHN09957.1 Interferon-induced guanylate-binding protein 1 [Glyci... 61 4e-08 XP_003542717.1 PREDICTED: guanylate-binding protein 1-like [Glyc... 61 4e-08 KRH10947.1 hypothetical protein GLYMA_15G078400 [Glycine max] 60 5e-08 KRH21347.1 hypothetical protein GLYMA_13G234600 [Glycine max] 60 1e-07 XP_003541721.1 PREDICTED: guanylate-binding protein 3-like [Glyc... 60 1e-07 CDO99475.1 unnamed protein product [Coffea canephora] 60 1e-07 XP_019251912.1 PREDICTED: guanylate-binding protein 7-like [Nico... 59 3e-07 XP_016438222.1 PREDICTED: guanylate-binding protein 1-like [Nico... 59 3e-07 XP_016434060.1 PREDICTED: guanylate-binding protein 5-like [Nico... 59 3e-07 XP_009802712.1 PREDICTED: guanylate-binding protein 5-like [Nico... 59 3e-07 >KOM31535.1 hypothetical protein LR48_Vigan01g109000 [Vigna angularis] Length = 256 Score = 65.5 bits (158), Expect = 5e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 3 HNYGDQLLRLKNPNKKDIVALYEKCVLQKS 92 HNYGDQLLRLKNPNKKDI+ALYEKCVLQKS Sbjct: 227 HNYGDQLLRLKNPNKKDIIALYEKCVLQKS 256 >XP_017440299.1 PREDICTED: guanylate-binding protein 1-like [Vigna angularis] BAT74413.1 hypothetical protein VIGAN_01207700 [Vigna angularis var. angularis] Length = 1061 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 3 HNYGDQLLRLKNPNKKDIVALYEKCVLQKS 92 HNYGDQLLRLKNPNKKDI+ALYEKCVLQKS Sbjct: 1032 HNYGDQLLRLKNPNKKDIIALYEKCVLQKS 1061 >XP_014493951.1 PREDICTED: guanylate-binding protein 1-like [Vigna radiata var. radiata] Length = 1061 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 3 HNYGDQLLRLKNPNKKDIVALYEKCVLQKS 92 HNYGDQLLRLKNPNKKDI+ALYEKCVLQKS Sbjct: 1032 HNYGDQLLRLKNPNKKDIIALYEKCVLQKS 1061 >XP_007156491.1 hypothetical protein PHAVU_003G290500g [Phaseolus vulgaris] ESW28485.1 hypothetical protein PHAVU_003G290500g [Phaseolus vulgaris] Length = 1062 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 3 HNYGDQLLRLKNPNKKDIVALYEKCVLQKS 92 HNYGDQLLRLKNPNKKDI+ALYEKCVLQKS Sbjct: 1033 HNYGDQLLRLKNPNKKDIIALYEKCVLQKS 1062 >KYP76312.1 Interferon-induced guanylate-binding protein 2 [Cajanus cajan] Length = 1033 Score = 64.7 bits (156), Expect = 2e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 3 HNYGDQLLRLKNPNKKDIVALYEKCVLQKS 92 HNYGDQLLRLKNPNKKD++ALYEKCVLQKS Sbjct: 1004 HNYGDQLLRLKNPNKKDLIALYEKCVLQKS 1033 >XP_004505099.1 PREDICTED: interferon-induced guanylate-binding protein 1 [Cicer arietinum] Length = 1062 Score = 64.7 bits (156), Expect = 2e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 3 HNYGDQLLRLKNPNKKDIVALYEKCVLQKS 92 HNYGDQLLRLKNPNKKDI+ALYEKCVLQKS Sbjct: 1033 HNYGDQLLRLKNPNKKDILALYEKCVLQKS 1062 >KHN15501.1 Interferon-induced guanylate-binding protein 1 [Glycine soja] Length = 1005 Score = 63.5 bits (153), Expect = 5e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 HNYGDQLLRLKNPNKKDIVALYEKCVLQKS 92 HNYGDQLLRLKNPNKKDI+ALYEKCVL KS Sbjct: 976 HNYGDQLLRLKNPNKKDIIALYEKCVLHKS 1005 >GAU32474.1 hypothetical protein TSUD_64240 [Trifolium subterraneum] Length = 1010 Score = 63.2 bits (152), Expect = 7e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 HNYGDQLLRLKNPNKKDIVALYEKCVLQKS 92 HNYGDQLLRLKNP KKDIVALYEKC+LQKS Sbjct: 981 HNYGDQLLRLKNPTKKDIVALYEKCILQKS 1010 >KRH50126.1 hypothetical protein GLYMA_07G202100 [Glycine max] Length = 1034 Score = 61.6 bits (148), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 HNYGDQLLRLKNPNKKDIVALYEKCVLQKS 92 HN+GDQLLRLKNPNKKDI+ALYEKCVL KS Sbjct: 1005 HNHGDQLLRLKNPNKKDIIALYEKCVLHKS 1034 >XP_003529353.1 PREDICTED: guanylate-binding protein 1-like [Glycine max] KRH50127.1 hypothetical protein GLYMA_07G202100 [Glycine max] Length = 1060 Score = 61.6 bits (148), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 HNYGDQLLRLKNPNKKDIVALYEKCVLQKS 92 HN+GDQLLRLKNPNKKDI+ALYEKCVL KS Sbjct: 1031 HNHGDQLLRLKNPNKKDIIALYEKCVLHKS 1060 >KHN09957.1 Interferon-induced guanylate-binding protein 1 [Glycine soja] Length = 1005 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +3 Query: 6 NYGDQLLRLKNPNKKDIVALYEKCVLQKS 92 NYGDQLLRLKNPNKK+I+ALYEKCVLQKS Sbjct: 977 NYGDQLLRLKNPNKKEIIALYEKCVLQKS 1005 >XP_003542717.1 PREDICTED: guanylate-binding protein 1-like [Glycine max] KRH20377.1 hypothetical protein GLYMA_13G174200 [Glycine max] Length = 1060 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +3 Query: 6 NYGDQLLRLKNPNKKDIVALYEKCVLQKS 92 NYGDQLLRLKNPNKK+I+ALYEKCVLQKS Sbjct: 1032 NYGDQLLRLKNPNKKEIIALYEKCVLQKS 1060 >KRH10947.1 hypothetical protein GLYMA_15G078400 [Glycine max] Length = 343 Score = 60.5 bits (145), Expect = 5e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 3 HNYGDQLLRLKNPNKKDIVALYEKCVLQKS 92 HNYGDQLL LKNPNKK I+ALYEKCVLQKS Sbjct: 314 HNYGDQLLELKNPNKKAIIALYEKCVLQKS 343 >KRH21347.1 hypothetical protein GLYMA_13G234600 [Glycine max] Length = 935 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 3 HNYGDQLLRLKNPNKKDIVALYEKCVLQKS 92 HNYGDQLL LKNPNKK I+ALYEKCVLQKS Sbjct: 906 HNYGDQLLELKNPNKKAILALYEKCVLQKS 935 >XP_003541721.1 PREDICTED: guanylate-binding protein 3-like [Glycine max] KHN08483.1 Guanylate-binding protein 6 [Glycine soja] KRH21346.1 hypothetical protein GLYMA_13G234600 [Glycine max] Length = 1059 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 3 HNYGDQLLRLKNPNKKDIVALYEKCVLQKS 92 HNYGDQLL LKNPNKK I+ALYEKCVLQKS Sbjct: 1030 HNYGDQLLELKNPNKKAILALYEKCVLQKS 1059 >CDO99475.1 unnamed protein product [Coffea canephora] Length = 1071 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = +3 Query: 3 HNYGDQLLRLKNPNKKDIVALYEKCVLQKS 92 HN+GD+LL+LKNPNKKDI+ALYEKCV+QKS Sbjct: 1042 HNFGDELLQLKNPNKKDILALYEKCVIQKS 1071 >XP_019251912.1 PREDICTED: guanylate-binding protein 7-like [Nicotiana attenuata] OIS99220.1 hypothetical protein A4A49_20843 [Nicotiana attenuata] Length = 1069 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = +3 Query: 3 HNYGDQLLRLKNPNKKDIVALYEKCVLQKS 92 H++GD+LL+LKNPNKKDI+ALYEKCVLQKS Sbjct: 1040 HDFGDELLQLKNPNKKDILALYEKCVLQKS 1069 >XP_016438222.1 PREDICTED: guanylate-binding protein 1-like [Nicotiana tabacum] Length = 1069 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = +3 Query: 3 HNYGDQLLRLKNPNKKDIVALYEKCVLQKS 92 H++GD+LL+LKNPNKKDI+ALYEKCVLQKS Sbjct: 1040 HDFGDELLQLKNPNKKDILALYEKCVLQKS 1069 >XP_016434060.1 PREDICTED: guanylate-binding protein 5-like [Nicotiana tabacum] Length = 1069 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = +3 Query: 3 HNYGDQLLRLKNPNKKDIVALYEKCVLQKS 92 H++GD+LL+LKNPNKKDI+ALYEKCVLQKS Sbjct: 1040 HDFGDELLQLKNPNKKDILALYEKCVLQKS 1069 >XP_009802712.1 PREDICTED: guanylate-binding protein 5-like [Nicotiana sylvestris] Length = 1069 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = +3 Query: 3 HNYGDQLLRLKNPNKKDIVALYEKCVLQKS 92 H++GD+LL+LKNPNKKDI+ALYEKCVLQKS Sbjct: 1040 HDFGDELLQLKNPNKKDILALYEKCVLQKS 1069