BLASTX nr result
ID: Glycyrrhiza32_contig00023759
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00023759 (215 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003518074.1 PREDICTED: BTB/POZ domain-containing protein At5g... 60 9e-09 KRH69996.1 hypothetical protein GLYMA_02G061400 [Glycine max] 60 9e-09 XP_014620719.1 PREDICTED: BTB/POZ domain-containing protein At5g... 60 9e-09 KHN13354.1 BTB/POZ domain-containing protein [Glycine soja] 59 1e-08 XP_003548908.1 PREDICTED: BTB/POZ domain-containing protein At5g... 59 2e-08 CDY45241.1 BnaA07g12490D [Brassica napus] 58 3e-08 XP_002307235.2 phototropic-responsive NPH3 family protein [Popul... 58 3e-08 XP_013653760.1 PREDICTED: BTB/POZ domain-containing protein At5g... 58 3e-08 ONH96681.1 hypothetical protein PRUPE_7G145600 [Prunus persica] 58 4e-08 XP_010557887.1 PREDICTED: BTB/POZ domain-containing protein At5g... 58 4e-08 XP_010557877.1 PREDICTED: BTB/POZ domain-containing protein At5g... 58 4e-08 XP_017189503.1 PREDICTED: BTB/POZ domain-containing protein At5g... 58 4e-08 XP_007203853.1 hypothetical protein PRUPE_ppa002346mg [Prunus pe... 58 4e-08 XP_008241595.1 PREDICTED: BTB/POZ domain-containing protein At5g... 58 4e-08 ONH96680.1 hypothetical protein PRUPE_7G145600 [Prunus persica] 58 4e-08 CBI38361.3 unnamed protein product, partial [Vitis vinifera] 57 6e-08 CDY30765.1 BnaC07g16650D [Brassica napus] 57 6e-08 XP_002272552.1 PREDICTED: BTB/POZ domain-containing protein At5g... 57 6e-08 XP_004509199.1 PREDICTED: BTB/POZ domain-containing protein At5g... 57 6e-08 XP_007155991.1 hypothetical protein PHAVU_003G249600g [Phaseolus... 57 6e-08 >XP_003518074.1 PREDICTED: BTB/POZ domain-containing protein At5g66560-like isoform X2 [Glycine max] KRH69997.1 hypothetical protein GLYMA_02G061400 [Glycine max] KRH69998.1 hypothetical protein GLYMA_02G061400 [Glycine max] Length = 655 Score = 59.7 bits (143), Expect = 9e-09 Identities = 29/56 (51%), Positives = 37/56 (66%) Frame = +3 Query: 3 FCTTGLPSDIVVEVDDMTFHLHKVSLTIYSYRISILLMQTQTRVYFQLQ*RQHFSE 170 FCTTGLPSDIVVEVDDMTFHLHK L S ++ +L+ Q + + +Q +E Sbjct: 15 FCTTGLPSDIVVEVDDMTFHLHKFPLMSKSRKLHLLITQQEAATHSSAAQQQQENE 70 >KRH69996.1 hypothetical protein GLYMA_02G061400 [Glycine max] Length = 660 Score = 59.7 bits (143), Expect = 9e-09 Identities = 29/56 (51%), Positives = 37/56 (66%) Frame = +3 Query: 3 FCTTGLPSDIVVEVDDMTFHLHKVSLTIYSYRISILLMQTQTRVYFQLQ*RQHFSE 170 FCTTGLPSDIVVEVDDMTFHLHK L S ++ +L+ Q + + +Q +E Sbjct: 15 FCTTGLPSDIVVEVDDMTFHLHKFPLMSKSRKLHLLITQQEAATHSSAAQQQQENE 70 >XP_014620719.1 PREDICTED: BTB/POZ domain-containing protein At5g66560-like isoform X1 [Glycine max] KRH69999.1 hypothetical protein GLYMA_02G061400 [Glycine max] Length = 680 Score = 59.7 bits (143), Expect = 9e-09 Identities = 29/56 (51%), Positives = 37/56 (66%) Frame = +3 Query: 3 FCTTGLPSDIVVEVDDMTFHLHKVSLTIYSYRISILLMQTQTRVYFQLQ*RQHFSE 170 FCTTGLPSDIVVEVDDMTFHLHK L S ++ +L+ Q + + +Q +E Sbjct: 40 FCTTGLPSDIVVEVDDMTFHLHKFPLMSKSRKLHLLITQQEAATHSSAAQQQQENE 95 >KHN13354.1 BTB/POZ domain-containing protein [Glycine soja] Length = 616 Score = 59.3 bits (142), Expect = 1e-08 Identities = 30/57 (52%), Positives = 37/57 (64%) Frame = +3 Query: 3 FCTTGLPSDIVVEVDDMTFHLHKVSLTIYSYRISILLMQTQTRVYFQLQ*RQHFSET 173 FCTTGLPSDIVVEVDDMTFHLHK L S ++ +L+ Q + + +Q ET Sbjct: 15 FCTTGLPSDIVVEVDDMTFHLHKFPLMSKSRKLHLLITQQEAASNSTVPQQQQQQET 71 >XP_003548908.1 PREDICTED: BTB/POZ domain-containing protein At5g66560-like [Glycine max] KRH08350.1 hypothetical protein GLYMA_16G143800 [Glycine max] KRH08351.1 hypothetical protein GLYMA_16G143800 [Glycine max] KRH08352.1 hypothetical protein GLYMA_16G143800 [Glycine max] Length = 648 Score = 58.9 bits (141), Expect = 2e-08 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +3 Query: 3 FCTTGLPSDIVVEVDDMTFHLHKVSLTIYSYRISILLMQTQ 125 FCTTGLPSDIVVEVDDMTFHLHK L S ++ +L+ Q + Sbjct: 15 FCTTGLPSDIVVEVDDMTFHLHKFPLMSKSRKLHLLITQQE 55 >CDY45241.1 BnaA07g12490D [Brassica napus] Length = 598 Score = 58.2 bits (139), Expect = 3e-08 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = +3 Query: 3 FCTTGLPSDIVVEVDDMTFHLHKVSLTIYSYRISILLMQTQTRVYFQL 146 FCTTGLPSDI +EVDDMTFHLHK L S ++ L+ + +TR + L Sbjct: 15 FCTTGLPSDIEIEVDDMTFHLHKFPLMSKSRKLHRLITEQETRSFSSL 62 >XP_002307235.2 phototropic-responsive NPH3 family protein [Populus trichocarpa] EEE94231.2 phototropic-responsive NPH3 family protein [Populus trichocarpa] Length = 627 Score = 58.2 bits (139), Expect = 3e-08 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +3 Query: 3 FCTTGLPSDIVVEVDDMTFHLHKVSLTIYSYRISILLMQTQT 128 FCTTGLPSDIV+EV+DMTFHLHK LT S ++ L+ + +T Sbjct: 14 FCTTGLPSDIVIEVEDMTFHLHKFPLTSRSRKLHQLITEQET 55 >XP_013653760.1 PREDICTED: BTB/POZ domain-containing protein At5g66560 [Brassica napus] Length = 669 Score = 58.2 bits (139), Expect = 3e-08 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = +3 Query: 3 FCTTGLPSDIVVEVDDMTFHLHKVSLTIYSYRISILLMQTQTRVYFQL 146 FCTTGLPSDI +EVDDMTFHLHK L S ++ L+ + +TR + L Sbjct: 15 FCTTGLPSDIEIEVDDMTFHLHKFPLMSKSRKLHRLITEQETRSFSSL 62 >ONH96681.1 hypothetical protein PRUPE_7G145600 [Prunus persica] Length = 504 Score = 57.8 bits (138), Expect = 4e-08 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +3 Query: 3 FCTTGLPSDIVVEVDDMTFHLHKVSLTIYSYRISILLMQTQT 128 FCTTGLPSDIVVEVDDMTFHLHK L S ++ L+ + +T Sbjct: 22 FCTTGLPSDIVVEVDDMTFHLHKFPLMSKSRKLHNLITEQET 63 >XP_010557887.1 PREDICTED: BTB/POZ domain-containing protein At5g66560 isoform X2 [Tarenaya hassleriana] Length = 657 Score = 57.8 bits (138), Expect = 4e-08 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = +3 Query: 3 FCTTGLPSDIVVEVDDMTFHLHKVSLTIYSYRISILLMQTQTRVY 137 FCTTGLPSDI +EVDDMTFHLHK L S ++ +L+ + +T+ + Sbjct: 2 FCTTGLPSDIEIEVDDMTFHLHKFPLMSKSGKLHLLITEQETKSF 46 >XP_010557877.1 PREDICTED: BTB/POZ domain-containing protein At5g66560 isoform X1 [Tarenaya hassleriana] Length = 667 Score = 57.8 bits (138), Expect = 4e-08 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = +3 Query: 3 FCTTGLPSDIVVEVDDMTFHLHKVSLTIYSYRISILLMQTQTRVY 137 FCTTGLPSDI +EVDDMTFHLHK L S ++ +L+ + +T+ + Sbjct: 12 FCTTGLPSDIEIEVDDMTFHLHKFPLMSKSGKLHLLITEQETKSF 56 >XP_017189503.1 PREDICTED: BTB/POZ domain-containing protein At5g66560-like [Malus domestica] Length = 672 Score = 57.8 bits (138), Expect = 4e-08 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +3 Query: 3 FCTTGLPSDIVVEVDDMTFHLHKVSLTIYSYRISILLMQTQT 128 FCTTGLPSDIVVEVDDMTFHLHK L S ++ L+ + +T Sbjct: 21 FCTTGLPSDIVVEVDDMTFHLHKFPLMSKSRKLHNLITEQET 62 >XP_007203853.1 hypothetical protein PRUPE_ppa002346mg [Prunus persica] Length = 684 Score = 57.8 bits (138), Expect = 4e-08 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +3 Query: 3 FCTTGLPSDIVVEVDDMTFHLHKVSLTIYSYRISILLMQTQT 128 FCTTGLPSDIVVEVDDMTFHLHK L S ++ L+ + +T Sbjct: 19 FCTTGLPSDIVVEVDDMTFHLHKFPLMSKSRKLHNLITEQET 60 >XP_008241595.1 PREDICTED: BTB/POZ domain-containing protein At5g66560 [Prunus mume] Length = 685 Score = 57.8 bits (138), Expect = 4e-08 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +3 Query: 3 FCTTGLPSDIVVEVDDMTFHLHKVSLTIYSYRISILLMQTQT 128 FCTTGLPSDIVVEVDDMTFHLHK L S ++ L+ + +T Sbjct: 19 FCTTGLPSDIVVEVDDMTFHLHKFPLMSKSRKLHNLITEQET 60 >ONH96680.1 hypothetical protein PRUPE_7G145600 [Prunus persica] Length = 687 Score = 57.8 bits (138), Expect = 4e-08 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +3 Query: 3 FCTTGLPSDIVVEVDDMTFHLHKVSLTIYSYRISILLMQTQT 128 FCTTGLPSDIVVEVDDMTFHLHK L S ++ L+ + +T Sbjct: 22 FCTTGLPSDIVVEVDDMTFHLHKFPLMSKSRKLHNLITEQET 63 >CBI38361.3 unnamed protein product, partial [Vitis vinifera] Length = 593 Score = 57.4 bits (137), Expect = 6e-08 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = +3 Query: 3 FCTTGLPSDIVVEVDDMTFHLHKVSLTIYSYRISILLMQTQT 128 FCTTGLPSDIV+EVDDMTFHLHK L S ++ L+ + +T Sbjct: 14 FCTTGLPSDIVIEVDDMTFHLHKFPLMSKSRKLHELITEQET 55 >CDY30765.1 BnaC07g16650D [Brassica napus] Length = 634 Score = 57.4 bits (137), Expect = 6e-08 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +3 Query: 3 FCTTGLPSDIVVEVDDMTFHLHKVSLTIYSYRISILLMQTQTRVY 137 FCTTGLPSDI +EVDDMTFHLHK L S ++ L+ + +TR + Sbjct: 15 FCTTGLPSDIEIEVDDMTFHLHKFPLMSKSRKLHRLITEQETRSF 59 >XP_002272552.1 PREDICTED: BTB/POZ domain-containing protein At5g66560 [Vitis vinifera] Length = 635 Score = 57.4 bits (137), Expect = 6e-08 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = +3 Query: 3 FCTTGLPSDIVVEVDDMTFHLHKVSLTIYSYRISILLMQTQT 128 FCTTGLPSDIV+EVDDMTFHLHK L S ++ L+ + +T Sbjct: 14 FCTTGLPSDIVIEVDDMTFHLHKFPLMSKSRKLHELITEQET 55 >XP_004509199.1 PREDICTED: BTB/POZ domain-containing protein At5g66560-like [Cicer arietinum] Length = 646 Score = 57.4 bits (137), Expect = 6e-08 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = +3 Query: 3 FCTTGLPSDIVVEVDDMTFHLHKVSLTIYSYRISILLMQTQ 125 FCTTGLPSDIVVEVDDMTFHLHK L S ++ L+ Q + Sbjct: 15 FCTTGLPSDIVVEVDDMTFHLHKFPLMSKSQKLHNLITQQE 55 >XP_007155991.1 hypothetical protein PHAVU_003G249600g [Phaseolus vulgaris] XP_007155992.1 hypothetical protein PHAVU_003G249600g [Phaseolus vulgaris] ESW27985.1 hypothetical protein PHAVU_003G249600g [Phaseolus vulgaris] ESW27986.1 hypothetical protein PHAVU_003G249600g [Phaseolus vulgaris] Length = 649 Score = 57.4 bits (137), Expect = 6e-08 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = +3 Query: 3 FCTTGLPSDIVVEVDDMTFHLHKVSLTIYSYRISILLMQTQTRVY 137 FCTTGLPSDIVVEVDDMTFHLHK L S ++ L+ Q + + Sbjct: 15 FCTTGLPSDIVVEVDDMTFHLHKFPLMSKSRKLHHLITQQEAAAH 59