BLASTX nr result
ID: Glycyrrhiza32_contig00023593
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00023593 (248 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value NP_054552.1 hypothetical protein NitaCp078 [Nicotiana tabacum] N... 67 4e-13 OAY56484.1 hypothetical protein MANES_02G020200, partial [Maniho... 54 4e-08 KDP22997.1 hypothetical protein JCGZ_01719 [Jatropha curcas] 54 2e-06 OMP07296.1 hypothetical protein COLO4_07468 [Corchorus olitorius] 53 2e-06 KMS94058.1 hypothetical protein BVRB_025220 [Beta vulgaris subsp... 49 5e-06 >NP_054552.1 hypothetical protein NitaCp078 [Nicotiana tabacum] NP_054565.1 hypothetical protein NitaCp091 [Nicotiana tabacum] YP_358732.1 hypothetical protein NisyCp089 [Nicotiana sylvestris] YP_358746.1 hypothetical protein NisyCp103 [Nicotiana sylvestris] YP_398918.1 hypothetical protein NitoCp088 [Nicotiana tomentosiformis] YP_398932.1 hypothetical protein NitoCp102 [Nicotiana tomentosiformis] YP_004891661.1 unnamed protein product (chloroplast) [Nicotiana undulata] YP_004891675.1 unnamed protein product (chloroplast) [Nicotiana undulata] CAA26288.1 hypothetical protein (chloroplast) [Nicotiana tabacum] CAA77393.1 hypothetical protein (chloroplast) [Nicotiana tabacum] AAA84690.1 unknown (chloroplast) [Nicotiana tabacum] CAA77400.1 hypothetical protein (chloroplast) [Nicotiana tabacum] BAE46709.1 hypothetical protein (chloroplast) [Nicotiana sylvestris] BAE46723.1 hypothetical protein (chloroplast) [Nicotiana sylvestris] BAE48058.1 hypothetical protein (chloroplast) [Nicotiana tomentosiformis] BAE48072.1 hypothetical protein (chloroplast) [Nicotiana tomentosiformis] AEO95619.1 hypothetical protein (chloroplast) [Nicotiana undulata] AEO95646.1 hypothetical protein (chloroplast) [Nicotiana undulata] AEO95728.1 hypothetical protein [synthetic construct] AEO95754.1 hypothetical protein [synthetic construct] AMM05595.1 hypothetical protein (plastid) [Nicotiana tabacum] prf||1211235CK ORF 75 Length = 75 Score = 67.4 bits (163), Expect = 4e-13 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = +3 Query: 78 MRHGTEPLRRSSTSYKKGNFELILMMG*EQE*NSMRSNLPVFLSSSVVER 227 MRH EPLRRSS SY+ G+FELIL+MG E+E NSMRSNL +FLSSSVVER Sbjct: 1 MRHVREPLRRSSGSYE-GSFELILVMGWERELNSMRSNLLLFLSSSVVER 49 >OAY56484.1 hypothetical protein MANES_02G020200, partial [Manihot esculenta] Length = 42 Score = 53.9 bits (128), Expect = 4e-08 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -2 Query: 226 RSTTELLRNTGKFDLIEFYSCSQPIINMSSKFP 128 RSTTELLRN G+ DLIEF S SQP+ NMSSKFP Sbjct: 9 RSTTELLRNNGRLDLIEFNSRSQPMTNMSSKFP 41 >KDP22997.1 hypothetical protein JCGZ_01719 [Jatropha curcas] Length = 742 Score = 53.9 bits (128), Expect = 2e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -2 Query: 226 RSTTELLRNTGKFDLIEFYSCSQPIINMSSKFP 128 RSTTELLRN G+FDLIEF S SQP+ NMS KFP Sbjct: 709 RSTTELLRNNGRFDLIEFNSRSQPMTNMSLKFP 741 >OMP07296.1 hypothetical protein COLO4_07468 [Corchorus olitorius] Length = 193 Score = 52.8 bits (125), Expect = 2e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -2 Query: 226 RSTTELLRNTGKFDLIEFYSCSQPIINMSSKFP 128 RSTTELLRN G+ DLIEF S SQP+ NM+SKFP Sbjct: 138 RSTTELLRNNGRLDLIEFNSRSQPMTNMNSKFP 170 >KMS94058.1 hypothetical protein BVRB_025220 [Beta vulgaris subsp. vulgaris] Length = 42 Score = 48.5 bits (114), Expect = 5e-06 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -2 Query: 226 RSTTELLRNTGKFDLIEFYSCSQPIINMSSKFP 128 RSTTELLRN + DLIEF S SQP+ NMSSK P Sbjct: 9 RSTTELLRNNKRLDLIEFNSRSQPMTNMSSKLP 41