BLASTX nr result
ID: Glycyrrhiza32_contig00023090
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00023090 (287 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_056237537.1 polyamine ABC transporter substrate-binding prote... 186 2e-56 WP_012456204.1 polyamine ABC transporter substrate-binding prote... 186 4e-56 BAU92989.1 family 1 extracellular solute-binding protein [Methyl... 185 6e-56 SFL83008.1 putrescine transport system substrate-binding protein... 185 9e-56 WP_056499878.1 polyamine ABC transporter substrate-binding prote... 184 1e-55 WP_015824167.1 polyamine ABC transporter substrate-binding prote... 184 1e-55 WP_076642213.1 spermidine/putrescine ABC transporter substrate-b... 184 1e-55 WP_012255173.1 MULTISPECIES: polyamine ABC transporter substrate... 184 1e-55 WP_060771273.1 polyamine ABC transporter substrate-binding prote... 184 1e-55 WP_056464414.1 polyamine ABC transporter substrate-binding prote... 184 1e-55 WP_003597542.1 polyamine ABC transporter substrate-binding prote... 184 1e-55 WP_015952244.1 polyamine ABC transporter substrate-binding prote... 184 2e-55 WP_056200048.1 polyamine ABC transporter substrate-binding prote... 184 2e-55 WP_056115554.1 MULTISPECIES: polyamine ABC transporter substrate... 182 1e-54 WP_055882187.1 MULTISPECIES: polyamine ABC transporter substrate... 181 3e-54 WP_017484140.1 polyamine ABC transporter substrate-binding prote... 181 3e-54 WP_056427729.1 MULTISPECIES: polyamine ABC transporter substrate... 180 8e-54 WP_056468229.1 polyamine ABC transporter substrate-binding prote... 179 2e-53 WP_051092989.1 polyamine ABC transporter substrate-binding prote... 177 5e-53 WP_056250535.1 polyamine ABC transporter substrate-binding prote... 177 5e-53 >WP_056237537.1 polyamine ABC transporter substrate-binding protein [Methylobacterium sp. Leaf456] KQT61423.1 spermidine/putrescine ABC transporter substrate-binding protein [Methylobacterium sp. Leaf456] Length = 369 Score = 186 bits (473), Expect = 2e-56 Identities = 89/95 (93%), Positives = 92/95 (96%) Frame = -3 Query: 285 RGSVRKFHSSEYVNGLANGDLCVAVGYSGDVLQAKKRAEESKNGVEIAYLIPKEGTLMWF 106 RG+VRKFHSSEY+NGLANGDLC+AVGYSGDVLQAKKRAEESKNGVEIAY IPKEGT MWF Sbjct: 217 RGAVRKFHSSEYINGLANGDLCLAVGYSGDVLQAKKRAEESKNGVEIAYFIPKEGTQMWF 276 Query: 105 DAFAIPKDAAHPAEAYAFIDYMMRPEVAAANTNFV 1 D FAIPKDAAHPAEAYAFIDYMMRPEVAAANTNFV Sbjct: 277 DTFAIPKDAAHPAEAYAFIDYMMRPEVAAANTNFV 311 >WP_012456204.1 polyamine ABC transporter substrate-binding protein [Methylobacterium populi] ACB82600.1 extracellular solute-binding protein family 1 [Methylobacterium populi BJ001] OAH32910.1 spermidine/putrescine ABC transporter substrate-binding protein [Methylobacterium populi] Length = 367 Score = 186 bits (471), Expect = 4e-56 Identities = 87/95 (91%), Positives = 93/95 (97%) Frame = -3 Query: 285 RGSVRKFHSSEYVNGLANGDLCVAVGYSGDVLQAKKRAEESKNGVEIAYLIPKEGTLMWF 106 RGS+RKFHSSEY+NGLANGD+C+AVGYSGDV+QAKKRAEESKNGVEIAY IPKEGTLMWF Sbjct: 215 RGSIRKFHSSEYINGLANGDVCLAVGYSGDVMQAKKRAEESKNGVEIAYFIPKEGTLMWF 274 Query: 105 DAFAIPKDAAHPAEAYAFIDYMMRPEVAAANTNFV 1 D FAIPKDAAHPAEA+AFIDYMMRPEVAAANTNFV Sbjct: 275 DTFAIPKDAAHPAEAHAFIDYMMRPEVAAANTNFV 309 >BAU92989.1 family 1 extracellular solute-binding protein [Methylobacterium populi] Length = 367 Score = 185 bits (470), Expect = 6e-56 Identities = 87/95 (91%), Positives = 93/95 (97%) Frame = -3 Query: 285 RGSVRKFHSSEYVNGLANGDLCVAVGYSGDVLQAKKRAEESKNGVEIAYLIPKEGTLMWF 106 RGSVRKFHSSEY+NGLANGD+C+AVGYSGDV+QAKKRAEESKNGVE+AY IPKEG LMWF Sbjct: 215 RGSVRKFHSSEYINGLANGDVCLAVGYSGDVMQAKKRAEESKNGVEVAYFIPKEGALMWF 274 Query: 105 DAFAIPKDAAHPAEAYAFIDYMMRPEVAAANTNFV 1 DAFAIPKDAAHPAEA+AFIDYMMRPEVAAANTNFV Sbjct: 275 DAFAIPKDAAHPAEAHAFIDYMMRPEVAAANTNFV 309 >SFL83008.1 putrescine transport system substrate-binding protein [Methylobacterium salsuginis] Length = 369 Score = 185 bits (469), Expect = 9e-56 Identities = 88/95 (92%), Positives = 91/95 (95%) Frame = -3 Query: 285 RGSVRKFHSSEYVNGLANGDLCVAVGYSGDVLQAKKRAEESKNGVEIAYLIPKEGTLMWF 106 RG+VRKFHSSEY+NGLANGDLC+AVGYSGDVLQAKKRAEESKNGVEIAY IPKEGT MWF Sbjct: 217 RGAVRKFHSSEYINGLANGDLCLAVGYSGDVLQAKKRAEESKNGVEIAYFIPKEGTQMWF 276 Query: 105 DAFAIPKDAAHPAEAYAFIDYMMRPEVAAANTNFV 1 D FAIPKDAAHP EAYAFIDYMMRPEVAAANTNFV Sbjct: 277 DTFAIPKDAAHPTEAYAFIDYMMRPEVAAANTNFV 311 >WP_056499878.1 polyamine ABC transporter substrate-binding protein [Methylobacterium sp. Leaf121] KQQ15115.1 spermidine/putrescine ABC transporter substrate-binding protein [Methylobacterium sp. Leaf121] Length = 366 Score = 184 bits (468), Expect = 1e-55 Identities = 87/95 (91%), Positives = 93/95 (97%) Frame = -3 Query: 285 RGSVRKFHSSEYVNGLANGDLCVAVGYSGDVLQAKKRAEESKNGVEIAYLIPKEGTLMWF 106 RG+VRKFHSSEYVNGLANGD+C+AVGYSGDV+QAKKRAEESKNG+EIAY IPKEG LMWF Sbjct: 214 RGAVRKFHSSEYVNGLANGDVCLAVGYSGDVMQAKKRAEESKNGIEIAYFIPKEGALMWF 273 Query: 105 DAFAIPKDAAHPAEAYAFIDYMMRPEVAAANTNFV 1 DAFAIPKDAAHPAEA+AFIDYMMRPEVAAANTNFV Sbjct: 274 DAFAIPKDAAHPAEAHAFIDYMMRPEVAAANTNFV 308 >WP_015824167.1 polyamine ABC transporter substrate-binding protein [Methylobacterium extorquens] CAX26627.1 putrescine transporter subunit: periplasmic-binding component of ABC superfamily [Methylobacterium extorquens DM4] Length = 366 Score = 184 bits (468), Expect = 1e-55 Identities = 87/95 (91%), Positives = 93/95 (97%) Frame = -3 Query: 285 RGSVRKFHSSEYVNGLANGDLCVAVGYSGDVLQAKKRAEESKNGVEIAYLIPKEGTLMWF 106 RG+VRKFHSSEYVNGLANGD+C+AVGYSGDV+QAKKRAEESKNG+EIAY IPKEG LMWF Sbjct: 214 RGAVRKFHSSEYVNGLANGDVCLAVGYSGDVMQAKKRAEESKNGIEIAYFIPKEGALMWF 273 Query: 105 DAFAIPKDAAHPAEAYAFIDYMMRPEVAAANTNFV 1 DAFAIPKDAAHPAEA+AFIDYMMRPEVAAANTNFV Sbjct: 274 DAFAIPKDAAHPAEAHAFIDYMMRPEVAAANTNFV 308 >WP_076642213.1 spermidine/putrescine ABC transporter substrate-binding protein PotF [Methylobacterium extorquens] APX85445.1 spermidine/putrescine ABC transporter substrate-binding protein PotF [Methylobacterium extorquens] Length = 367 Score = 184 bits (468), Expect = 1e-55 Identities = 87/95 (91%), Positives = 93/95 (97%) Frame = -3 Query: 285 RGSVRKFHSSEYVNGLANGDLCVAVGYSGDVLQAKKRAEESKNGVEIAYLIPKEGTLMWF 106 RG+VRKFHSSEYVNGLANGD+C+AVGYSGDV+QAKKRAEESKNG+EIAY IPKEG LMWF Sbjct: 215 RGAVRKFHSSEYVNGLANGDVCLAVGYSGDVMQAKKRAEESKNGIEIAYFIPKEGALMWF 274 Query: 105 DAFAIPKDAAHPAEAYAFIDYMMRPEVAAANTNFV 1 DAFAIPKDAAHPAEA+AFIDYMMRPEVAAANTNFV Sbjct: 275 DAFAIPKDAAHPAEAHAFIDYMMRPEVAAANTNFV 309 >WP_012255173.1 MULTISPECIES: polyamine ABC transporter substrate-binding protein [Methylobacterium] ABY32389.1 extracellular solute-binding protein family 1 [Methylobacterium extorquens PA1] KQP95888.1 spermidine/putrescine ABC transporter substrate-binding protein [Methylobacterium sp. Leaf119] Length = 367 Score = 184 bits (468), Expect = 1e-55 Identities = 87/95 (91%), Positives = 93/95 (97%) Frame = -3 Query: 285 RGSVRKFHSSEYVNGLANGDLCVAVGYSGDVLQAKKRAEESKNGVEIAYLIPKEGTLMWF 106 RG+VRKFHSSEYVNGLANGD+C+AVGYSGDV+QAKKRAEESKNG+EIAY IPKEG LMWF Sbjct: 215 RGAVRKFHSSEYVNGLANGDVCLAVGYSGDVMQAKKRAEESKNGIEIAYFIPKEGALMWF 274 Query: 105 DAFAIPKDAAHPAEAYAFIDYMMRPEVAAANTNFV 1 DAFAIPKDAAHPAEA+AFIDYMMRPEVAAANTNFV Sbjct: 275 DAFAIPKDAAHPAEAHAFIDYMMRPEVAAANTNFV 309 >WP_060771273.1 polyamine ABC transporter substrate-binding protein [Methylobacterium sp. AMS5] AMB47233.1 putrescine/spermidine ABC transporter substrate-binding protein [Methylobacterium sp. AMS5] Length = 367 Score = 184 bits (468), Expect = 1e-55 Identities = 87/95 (91%), Positives = 93/95 (97%) Frame = -3 Query: 285 RGSVRKFHSSEYVNGLANGDLCVAVGYSGDVLQAKKRAEESKNGVEIAYLIPKEGTLMWF 106 RG+VRKFHSSEYVNGLANGD+C+AVGYSGDV+QAKKRAEESKNG+EIAY IPKEG LMWF Sbjct: 215 RGAVRKFHSSEYVNGLANGDVCLAVGYSGDVMQAKKRAEESKNGIEIAYFIPKEGALMWF 274 Query: 105 DAFAIPKDAAHPAEAYAFIDYMMRPEVAAANTNFV 1 DAFAIPKDAAHPAEA+AFIDYMMRPEVAAANTNFV Sbjct: 275 DAFAIPKDAAHPAEAHAFIDYMMRPEVAAANTNFV 309 >WP_056464414.1 polyamine ABC transporter substrate-binding protein [Methylobacterium sp. Leaf90] KQO77278.1 spermidine/putrescine ABC transporter substrate-binding protein [Methylobacterium sp. Leaf90] Length = 367 Score = 184 bits (468), Expect = 1e-55 Identities = 87/95 (91%), Positives = 93/95 (97%) Frame = -3 Query: 285 RGSVRKFHSSEYVNGLANGDLCVAVGYSGDVLQAKKRAEESKNGVEIAYLIPKEGTLMWF 106 RG+VRKFHSSEYVNGLANGD+C+AVGYSGDV+QAKKRAEESKNG+EIAY IPKEG LMWF Sbjct: 215 RGAVRKFHSSEYVNGLANGDVCLAVGYSGDVMQAKKRAEESKNGIEIAYFIPKEGALMWF 274 Query: 105 DAFAIPKDAAHPAEAYAFIDYMMRPEVAAANTNFV 1 DAFAIPKDAAHPAEA+AFIDYMMRPEVAAANTNFV Sbjct: 275 DAFAIPKDAAHPAEAHAFIDYMMRPEVAAANTNFV 309 >WP_003597542.1 polyamine ABC transporter substrate-binding protein [Methylobacterium extorquens] EHP94142.1 extracellular solute-binding protein family 1 [Methylobacterium extorquens DSM 13060] Length = 367 Score = 184 bits (468), Expect = 1e-55 Identities = 87/95 (91%), Positives = 93/95 (97%) Frame = -3 Query: 285 RGSVRKFHSSEYVNGLANGDLCVAVGYSGDVLQAKKRAEESKNGVEIAYLIPKEGTLMWF 106 RG+VRKFHSSEYVNGLANGD+C+AVGYSGDV+QAKKRAEESKNG+EIAY IPKEG LMWF Sbjct: 215 RGAVRKFHSSEYVNGLANGDVCLAVGYSGDVMQAKKRAEESKNGIEIAYFIPKEGALMWF 274 Query: 105 DAFAIPKDAAHPAEAYAFIDYMMRPEVAAANTNFV 1 DAFAIPKDAAHPAEA+AFIDYMMRPEVAAANTNFV Sbjct: 275 DAFAIPKDAAHPAEAHAFIDYMMRPEVAAANTNFV 309 >WP_015952244.1 polyamine ABC transporter substrate-binding protein [Methylobacterium extorquens] ACK85164.1 extracellular solute-binding protein family 1 [Methylobacterium extorquens CM4] Length = 367 Score = 184 bits (467), Expect = 2e-55 Identities = 86/95 (90%), Positives = 93/95 (97%) Frame = -3 Query: 285 RGSVRKFHSSEYVNGLANGDLCVAVGYSGDVLQAKKRAEESKNGVEIAYLIPKEGTLMWF 106 RG+VRKFHSSEYVNGLANGD+C+AVGYSGDV+QAKKRAEESKNG+EIAY IPKEG LMWF Sbjct: 215 RGAVRKFHSSEYVNGLANGDVCLAVGYSGDVMQAKKRAEESKNGIEIAYFIPKEGALMWF 274 Query: 105 DAFAIPKDAAHPAEAYAFIDYMMRPEVAAANTNFV 1 DAFA+PKDAAHPAEA+AFIDYMMRPEVAAANTNFV Sbjct: 275 DAFAVPKDAAHPAEAHAFIDYMMRPEVAAANTNFV 309 >WP_056200048.1 polyamine ABC transporter substrate-binding protein [Methylobacterium sp. Leaf123] KQQ18280.1 spermidine/putrescine ABC transporter substrate-binding protein [Methylobacterium sp. Leaf123] Length = 367 Score = 184 bits (467), Expect = 2e-55 Identities = 86/95 (90%), Positives = 93/95 (97%) Frame = -3 Query: 285 RGSVRKFHSSEYVNGLANGDLCVAVGYSGDVLQAKKRAEESKNGVEIAYLIPKEGTLMWF 106 RG+VRKFHSSEYVNGLANGD+C+AVGYSGDV+QAKKRAEESKNG+E+AY IPKEG LMWF Sbjct: 215 RGAVRKFHSSEYVNGLANGDVCLAVGYSGDVMQAKKRAEESKNGIEVAYFIPKEGALMWF 274 Query: 105 DAFAIPKDAAHPAEAYAFIDYMMRPEVAAANTNFV 1 DAFAIPKDAAHPAEA+AFIDYMMRPEVAAANTNFV Sbjct: 275 DAFAIPKDAAHPAEAHAFIDYMMRPEVAAANTNFV 309 >WP_056115554.1 MULTISPECIES: polyamine ABC transporter substrate-binding protein [Methylobacterium] KQO94171.1 spermidine/putrescine ABC transporter substrate-binding protein [Methylobacterium sp. Leaf92] KQQ17670.1 spermidine/putrescine ABC transporter substrate-binding protein [Methylobacterium sp. Leaf122] Length = 366 Score = 182 bits (462), Expect = 1e-54 Identities = 86/95 (90%), Positives = 92/95 (96%) Frame = -3 Query: 285 RGSVRKFHSSEYVNGLANGDLCVAVGYSGDVLQAKKRAEESKNGVEIAYLIPKEGTLMWF 106 RG+VRKFHSSEYVNGLANGD+C+AVGYSGDV+QAKKRAEESKN +EIAY IPKEG LMWF Sbjct: 214 RGAVRKFHSSEYVNGLANGDVCLAVGYSGDVMQAKKRAEESKNSIEIAYFIPKEGALMWF 273 Query: 105 DAFAIPKDAAHPAEAYAFIDYMMRPEVAAANTNFV 1 DAFAIPKDAAHPAEA+AFIDYMMRPEVAAANTNFV Sbjct: 274 DAFAIPKDAAHPAEAHAFIDYMMRPEVAAANTNFV 308 >WP_055882187.1 MULTISPECIES: polyamine ABC transporter substrate-binding protein [Methylobacterium] KQP59179.1 spermidine/putrescine ABC transporter substrate-binding protein [Methylobacterium sp. Leaf108] KQT18673.1 spermidine/putrescine ABC transporter substrate-binding protein [Methylobacterium sp. Leaf399] KQT88849.1 spermidine/putrescine ABC transporter substrate-binding protein [Methylobacterium sp. Leaf466] Length = 366 Score = 181 bits (459), Expect = 3e-54 Identities = 83/95 (87%), Positives = 92/95 (96%) Frame = -3 Query: 285 RGSVRKFHSSEYVNGLANGDLCVAVGYSGDVLQAKKRAEESKNGVEIAYLIPKEGTLMWF 106 RGSVRKFHSSEY+NGLANGD+C+AVGYSGDV+QA+KRAEE+KNGVEIAYL+PKEG LMWF Sbjct: 214 RGSVRKFHSSEYINGLANGDICLAVGYSGDVMQARKRAEEAKNGVEIAYLVPKEGALMWF 273 Query: 105 DAFAIPKDAAHPAEAYAFIDYMMRPEVAAANTNFV 1 DAFAIPKDA HPAEAYAF+DYM+RPEVAAAN NFV Sbjct: 274 DAFAIPKDAPHPAEAYAFLDYMLRPEVAAANANFV 308 >WP_017484140.1 polyamine ABC transporter substrate-binding protein [Methylobacterium sp. MB200] Length = 367 Score = 181 bits (459), Expect = 3e-54 Identities = 85/95 (89%), Positives = 92/95 (96%) Frame = -3 Query: 285 RGSVRKFHSSEYVNGLANGDLCVAVGYSGDVLQAKKRAEESKNGVEIAYLIPKEGTLMWF 106 RGSVRKFHSSEY+NGLANGD+C+AVGYSGDV+QA+KRAEESKNGVE+AY IPKEG LMWF Sbjct: 215 RGSVRKFHSSEYINGLANGDVCLAVGYSGDVMQARKRAEESKNGVEVAYFIPKEGALMWF 274 Query: 105 DAFAIPKDAAHPAEAYAFIDYMMRPEVAAANTNFV 1 DAFAIPKDAAH AEA+AFIDYMMRPEVAAANTNFV Sbjct: 275 DAFAIPKDAAHSAEAHAFIDYMMRPEVAAANTNFV 309 >WP_056427729.1 MULTISPECIES: polyamine ABC transporter substrate-binding protein [Methylobacterium] KQO57091.1 spermidine/putrescine ABC transporter substrate-binding protein [Methylobacterium sp. Leaf86] KQO93673.1 spermidine/putrescine ABC transporter substrate-binding protein [Methylobacterium sp. Leaf91] Length = 368 Score = 180 bits (456), Expect = 8e-54 Identities = 85/95 (89%), Positives = 90/95 (94%) Frame = -3 Query: 285 RGSVRKFHSSEYVNGLANGDLCVAVGYSGDVLQAKKRAEESKNGVEIAYLIPKEGTLMWF 106 RGSVRKFHSSEY+NGLANGDLC+AVGYSGDV+QAKKRAEESKNGVEIAY IPKEG LMWF Sbjct: 216 RGSVRKFHSSEYINGLANGDLCLAVGYSGDVMQAKKRAEESKNGVEIAYFIPKEGALMWF 275 Query: 105 DAFAIPKDAAHPAEAYAFIDYMMRPEVAAANTNFV 1 DAFAIPKDA HP EA+ FIDYMMRP+VAAANTNFV Sbjct: 276 DAFAIPKDAPHPEEAHLFIDYMMRPDVAAANTNFV 310 >WP_056468229.1 polyamine ABC transporter substrate-binding protein [Methylobacterium sp. Leaf104] KQP41412.1 spermidine/putrescine ABC transporter substrate-binding protein [Methylobacterium sp. Leaf104] Length = 380 Score = 179 bits (455), Expect = 2e-53 Identities = 83/95 (87%), Positives = 92/95 (96%) Frame = -3 Query: 285 RGSVRKFHSSEYVNGLANGDLCVAVGYSGDVLQAKKRAEESKNGVEIAYLIPKEGTLMWF 106 RGSVRKFHSSEY+NGLANGDLC+AVGYSGDV+QA+KRAEE+KNGVEI Y+IP+EG LMWF Sbjct: 228 RGSVRKFHSSEYINGLANGDLCLAVGYSGDVMQARKRAEEAKNGVEIGYVIPREGALMWF 287 Query: 105 DAFAIPKDAAHPAEAYAFIDYMMRPEVAAANTNFV 1 DAFAIPKDA HPAEA+AF+DYMMRPEVAAANTNFV Sbjct: 288 DAFAIPKDAPHPAEAHAFLDYMMRPEVAAANTNFV 322 >WP_051092989.1 polyamine ABC transporter substrate-binding protein [Methylobacterium sp. 77] Length = 359 Score = 177 bits (450), Expect = 5e-53 Identities = 84/95 (88%), Positives = 89/95 (93%) Frame = -3 Query: 285 RGSVRKFHSSEYVNGLANGDLCVAVGYSGDVLQAKKRAEESKNGVEIAYLIPKEGTLMWF 106 RGSVRKFHSSEY+NGLANGDLC+AVGYSGDV+QAKKRA+ESKNGVEIAY IPKEG LMWF Sbjct: 207 RGSVRKFHSSEYINGLANGDLCLAVGYSGDVMQAKKRADESKNGVEIAYFIPKEGALMWF 266 Query: 105 DAFAIPKDAAHPAEAYAFIDYMMRPEVAAANTNFV 1 DA AIPKDA HP EA+ FIDYMMRPEVAAANTNFV Sbjct: 267 DALAIPKDAPHPEEAHIFIDYMMRPEVAAANTNFV 301 >WP_056250535.1 polyamine ABC transporter substrate-binding protein [Methylobacterium sp. Leaf93] KQP15545.1 spermidine/putrescine ABC transporter substrate-binding protein [Methylobacterium sp. Leaf93] Length = 360 Score = 177 bits (450), Expect = 5e-53 Identities = 84/95 (88%), Positives = 89/95 (93%) Frame = -3 Query: 285 RGSVRKFHSSEYVNGLANGDLCVAVGYSGDVLQAKKRAEESKNGVEIAYLIPKEGTLMWF 106 RGSVRKFHSSEY+NGLANGDLC+AVGYSGDV+QAKKRAEESKNGVEIAY IPKEG LMWF Sbjct: 208 RGSVRKFHSSEYINGLANGDLCLAVGYSGDVMQAKKRAEESKNGVEIAYFIPKEGALMWF 267 Query: 105 DAFAIPKDAAHPAEAYAFIDYMMRPEVAAANTNFV 1 DA AIPKDA HP EA+ FIDY+MRPEVAAANTNFV Sbjct: 268 DALAIPKDAPHPEEAHRFIDYLMRPEVAAANTNFV 302