BLASTX nr result
ID: Glycyrrhiza32_contig00023030
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00023030 (632 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007157653.1 hypothetical protein PHAVU_002G087300g [Phaseolus... 67 2e-09 XP_007157654.1 hypothetical protein PHAVU_002G087300g [Phaseolus... 67 2e-09 KRH54634.1 hypothetical protein GLYMA_06G199800 [Glycine max] 67 3e-09 KHN06904.1 Zinc finger Ran-binding domain-containing protein 3 [... 67 3e-09 XP_006581993.1 PREDICTED: DNA annealing helicase and endonucleas... 67 3e-09 XP_014632071.1 PREDICTED: DNA annealing helicase and endonucleas... 67 3e-09 GAU38443.1 hypothetical protein TSUD_151660 [Trifolium subterran... 66 3e-09 XP_004499415.1 PREDICTED: DNA annealing helicase and endonucleas... 61 6e-08 KYP55768.1 Zinc finger Ran-binding domain-containing protein 3 [... 62 1e-07 XP_004499416.1 PREDICTED: DNA annealing helicase and endonucleas... 61 2e-07 >XP_007157653.1 hypothetical protein PHAVU_002G087300g [Phaseolus vulgaris] ESW29647.1 hypothetical protein PHAVU_002G087300g [Phaseolus vulgaris] Length = 1164 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -1 Query: 632 LMNNMKNDTKDAAGPNIKDHRLLEVKESKLEDELLVKVPGSAYSLANS 489 LMN+MKN K +AG NIKDHR+++ + S +EDELLV+VPGSAYSLA+S Sbjct: 1117 LMNSMKNGIKGSAGANIKDHRVIDERGSIIEDELLVEVPGSAYSLADS 1164 >XP_007157654.1 hypothetical protein PHAVU_002G087300g [Phaseolus vulgaris] ESW29648.1 hypothetical protein PHAVU_002G087300g [Phaseolus vulgaris] Length = 1166 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -1 Query: 632 LMNNMKNDTKDAAGPNIKDHRLLEVKESKLEDELLVKVPGSAYSLANS 489 LMN+MKN K +AG NIKDHR+++ + S +EDELLV+VPGSAYSLA+S Sbjct: 1119 LMNSMKNGIKGSAGANIKDHRVIDERGSIIEDELLVEVPGSAYSLADS 1166 >KRH54634.1 hypothetical protein GLYMA_06G199800 [Glycine max] Length = 744 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = -1 Query: 632 LMNNMKNDTKDAAGPNIKDHRLLEVKESKLEDELLVKVPGSAYSLANS 489 LMN+MKN K A G N KDH+LLE + S +EDELLV+VPGSAYSLA+S Sbjct: 697 LMNSMKNGIKGATGTNTKDHKLLEEEGSMVEDELLVEVPGSAYSLADS 744 >KHN06904.1 Zinc finger Ran-binding domain-containing protein 3 [Glycine soja] Length = 744 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = -1 Query: 632 LMNNMKNDTKDAAGPNIKDHRLLEVKESKLEDELLVKVPGSAYSLANS 489 LMN+MKN K A G N KDH+LLE + S +EDELLV+VPGSAYSLA+S Sbjct: 697 LMNSMKNGIKGATGTNTKDHKLLEEEGSMVEDELLVEVPGSAYSLADS 744 >XP_006581993.1 PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform X2 [Glycine max] Length = 1177 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = -1 Query: 632 LMNNMKNDTKDAAGPNIKDHRLLEVKESKLEDELLVKVPGSAYSLANS 489 LMN+MKN K A G N KDH+LLE + S +EDELLV+VPGSAYSLA+S Sbjct: 1130 LMNSMKNGIKGATGTNTKDHKLLEEEGSMVEDELLVEVPGSAYSLADS 1177 >XP_014632071.1 PREDICTED: DNA annealing helicase and endonuclease ZRANB3 isoform X1 [Glycine max] Length = 1178 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = -1 Query: 632 LMNNMKNDTKDAAGPNIKDHRLLEVKESKLEDELLVKVPGSAYSLANS 489 LMN+MKN K A G N KDH+LLE + S +EDELLV+VPGSAYSLA+S Sbjct: 1131 LMNSMKNGIKGATGTNTKDHKLLEEEGSMVEDELLVEVPGSAYSLADS 1178 >GAU38443.1 hypothetical protein TSUD_151660 [Trifolium subterraneum] Length = 610 Score = 66.2 bits (160), Expect = 3e-09 Identities = 34/55 (61%), Positives = 39/55 (70%) Frame = -1 Query: 632 LMNNMKNDTKDAAGPNIKDHRLLEVKESKLEDELLVKVPGSAYSLANSKESGDAA 468 LMN MKN K AG N KD L +E+ ED++LV VPGSAYSLANS+ESGD A Sbjct: 555 LMNTMKNSMKGVAGTNNKDQLLYAEQENMHEDDILVPVPGSAYSLANSQESGDVA 609 >XP_004499415.1 PREDICTED: DNA annealing helicase and endonuclease ZRANB3-like [Cicer arietinum] Length = 198 Score = 60.8 bits (146), Expect = 6e-08 Identities = 34/55 (61%), Positives = 41/55 (74%) Frame = -1 Query: 632 LMNNMKNDTKDAAGPNIKDHRLLEVKESKLEDELLVKVPGSAYSLANSKESGDAA 468 LMN MKN +I+DHRL +ES L+DE+LVKVPGS+YSLAN +ESGDAA Sbjct: 151 LMNAMKN--------SIEDHRLQGGQESLLDDEVLVKVPGSSYSLANIQESGDAA 197 >KYP55768.1 Zinc finger Ran-binding domain-containing protein 3 [Cajanus cajan] Length = 1071 Score = 61.6 bits (148), Expect = 1e-07 Identities = 34/49 (69%), Positives = 38/49 (77%), Gaps = 1/49 (2%) Frame = -1 Query: 632 LMNNMKNDTKDAAGPNIKDHRLLEVKESKL-EDELLVKVPGSAYSLANS 489 LMN+MKND K AA IKD R LE KE + EDELLV+VPGSAYSLA+S Sbjct: 1023 LMNSMKNDIKSAASSKIKDCRRLEDKEGNMPEDELLVEVPGSAYSLADS 1071 >XP_004499416.1 PREDICTED: DNA annealing helicase and endonuclease ZRANB3 [Cicer arietinum] Length = 1146 Score = 61.2 bits (147), Expect = 2e-07 Identities = 34/55 (61%), Positives = 41/55 (74%) Frame = -1 Query: 632 LMNNMKNDTKDAAGPNIKDHRLLEVKESKLEDELLVKVPGSAYSLANSKESGDAA 468 LMN MKN +I+DHRL +ES L+DE+LVKVPGS+YSLAN +ESGDAA Sbjct: 1099 LMNAMKN--------SIEDHRLQGEQESLLDDEVLVKVPGSSYSLANIQESGDAA 1145