BLASTX nr result
ID: Glycyrrhiza32_contig00022749
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00022749 (279 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013458334.1 myb transcription factor [Medicago truncatula] KE... 63 1e-09 XP_004508108.1 PREDICTED: transcription factor MYB108 [Cicer ari... 61 7e-09 XP_015938200.1 PREDICTED: transcription factor MYB108 [Arachis d... 57 2e-07 XP_016177884.1 PREDICTED: transcription factor MYB108-like [Arac... 57 2e-07 KYP52596.1 Myb-related protein 305 family [Cajanus cajan] 54 3e-06 BAT77017.1 hypothetical protein VIGAN_01509600 [Vigna angularis ... 52 7e-06 XP_017428230.1 PREDICTED: transcription factor MYB108-like [Vign... 52 7e-06 >XP_013458334.1 myb transcription factor [Medicago truncatula] KEH32365.1 myb transcription factor [Medicago truncatula] Length = 315 Score = 62.8 bits (151), Expect = 1e-09 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +1 Query: 4 WMQNGDSSDIFWNAENVLFLQQQLMNDTM 90 WMQ+GDSSDIFWNAEN+LFLQQQLMNDTM Sbjct: 287 WMQSGDSSDIFWNAENMLFLQQQLMNDTM 315 >XP_004508108.1 PREDICTED: transcription factor MYB108 [Cicer arietinum] Length = 305 Score = 60.8 bits (146), Expect = 7e-09 Identities = 28/31 (90%), Positives = 30/31 (96%), Gaps = 1/31 (3%) Frame = +1 Query: 1 PW-MQNGDSSDIFWNAENVLFLQQQLMNDTM 90 PW MQ+GDSSDIFWNAEN+LFLQQQLMNDTM Sbjct: 275 PWIMQSGDSSDIFWNAENMLFLQQQLMNDTM 305 >XP_015938200.1 PREDICTED: transcription factor MYB108 [Arachis duranensis] Length = 325 Score = 57.0 bits (136), Expect = 2e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +1 Query: 1 PWMQNGDSSDIFWNAENVLFLQQQLMNDTM 90 PWMQ+GD+SD FWN EN+LFL+QQLMND M Sbjct: 296 PWMQSGDTSDNFWNVENMLFLEQQLMNDNM 325 >XP_016177884.1 PREDICTED: transcription factor MYB108-like [Arachis ipaensis] Length = 327 Score = 57.0 bits (136), Expect = 2e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +1 Query: 1 PWMQNGDSSDIFWNAENVLFLQQQLMNDTM 90 PWMQ+GD+SD FWN EN+LFL+QQLMND M Sbjct: 298 PWMQSGDTSDNFWNVENMLFLEQQLMNDNM 327 >KYP52596.1 Myb-related protein 305 family [Cajanus cajan] Length = 323 Score = 53.5 bits (127), Expect = 3e-06 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 1/31 (3%) Frame = +1 Query: 1 PW-MQNGDSSDIFWNAENVLFLQQQLMNDTM 90 PW MQ+GDSSD FWN EN+LFL+QQLMND M Sbjct: 293 PWNMQSGDSSDNFWNVENMLFLEQQLMNDNM 323 >BAT77017.1 hypothetical protein VIGAN_01509600 [Vigna angularis var. angularis] Length = 297 Score = 52.4 bits (124), Expect = 7e-06 Identities = 23/31 (74%), Positives = 26/31 (83%), Gaps = 1/31 (3%) Frame = +1 Query: 1 PW-MQNGDSSDIFWNAENVLFLQQQLMNDTM 90 PW +QNGDSSD FWN EN+LFL+Q LMND M Sbjct: 267 PWNLQNGDSSDNFWNVENMLFLEQHLMNDNM 297 >XP_017428230.1 PREDICTED: transcription factor MYB108-like [Vigna angularis] KOM33397.1 hypothetical protein LR48_Vigan01g295300 [Vigna angularis] Length = 314 Score = 52.4 bits (124), Expect = 7e-06 Identities = 23/31 (74%), Positives = 26/31 (83%), Gaps = 1/31 (3%) Frame = +1 Query: 1 PW-MQNGDSSDIFWNAENVLFLQQQLMNDTM 90 PW +QNGDSSD FWN EN+LFL+Q LMND M Sbjct: 284 PWNLQNGDSSDNFWNVENMLFLEQHLMNDNM 314