BLASTX nr result
ID: Glycyrrhiza32_contig00022556
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00022556 (251 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY32908.1 hypothetical protein MANES_13G055200 [Manihot esculenta] 52 9e-07 >OAY32908.1 hypothetical protein MANES_13G055200 [Manihot esculenta] Length = 105 Score = 52.0 bits (123), Expect = 9e-07 Identities = 24/47 (51%), Positives = 27/47 (57%) Frame = +3 Query: 111 QTPGHLYYLHPIENXXXXXXXXXXXXKNYHSWARLMKKALINKNKIR 251 Q P + YYLHP EN KNYH WAR MK AL++KNK R Sbjct: 17 QNPSNPYYLHPNENPSLVLVSTLLNEKNYHPWARAMKMALLSKNKYR 63