BLASTX nr result
ID: Glycyrrhiza32_contig00022312
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00022312 (213 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN41670.1 Hypothetical protein glysoja_036414 [Glycine soja] 55 3e-07 KRH41499.1 hypothetical protein GLYMA_08G033800 [Glycine max] KR... 55 3e-07 KHN16641.1 Hypothetical protein glysoja_002738 [Glycine soja] 55 4e-07 KRH41497.1 hypothetical protein GLYMA_08G033800 [Glycine max] 55 5e-07 XP_003525286.1 PREDICTED: probable protein phosphatase 2C 6 [Gly... 55 5e-07 XP_003530510.1 PREDICTED: probable protein phosphatase 2C 6 [Gly... 55 5e-07 XP_014505739.1 PREDICTED: probable protein phosphatase 2C 6 [Vig... 55 5e-07 XP_007160290.1 hypothetical protein PHAVU_002G309100g [Phaseolus... 55 5e-07 XP_004503481.1 PREDICTED: probable protein phosphatase 2C 6 [Cic... 54 7e-07 GAU11729.1 hypothetical protein TSUD_74800 [Trifolium subterraneum] 53 1e-06 XP_016188716.1 PREDICTED: probable protein phosphatase 2C 6 [Ara... 52 4e-06 KYP67477.1 putative protein phosphatase 2C 6 [Cajanus cajan] 52 6e-06 XP_017442239.1 PREDICTED: probable protein phosphatase 2C 6 [Vig... 52 6e-06 XP_003630720.1 protein phosphatase 2C-like protein [Medicago tru... 52 6e-06 XP_015954202.1 PREDICTED: probable protein phosphatase 2C 6 [Ara... 51 8e-06 >KHN41670.1 Hypothetical protein glysoja_036414 [Glycine soja] Length = 230 Score = 54.7 bits (130), Expect = 3e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 3 RNSKDNISIIVVDLKSKRKRQQRPPSIS 86 RNSKDNISIIVVDLKSKRKRQQRPP IS Sbjct: 203 RNSKDNISIIVVDLKSKRKRQQRPPLIS 230 >KRH41499.1 hypothetical protein GLYMA_08G033800 [Glycine max] KRH41500.1 hypothetical protein GLYMA_08G033800 [Glycine max] KRH41501.1 hypothetical protein GLYMA_08G033800 [Glycine max] Length = 239 Score = 54.7 bits (130), Expect = 3e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 3 RNSKDNISIIVVDLKSKRKRQQRPPSIS 86 RNSKDNISIIVVDLKSKRKRQQRPP IS Sbjct: 212 RNSKDNISIIVVDLKSKRKRQQRPPLIS 239 >KHN16641.1 Hypothetical protein glysoja_002738 [Glycine soja] Length = 287 Score = 54.7 bits (130), Expect = 4e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 3 RNSKDNISIIVVDLKSKRKRQQRPPSIS 86 RNSKDNISIIVVDLKSKRKRQQRPP IS Sbjct: 260 RNSKDNISIIVVDLKSKRKRQQRPPLIS 287 >KRH41497.1 hypothetical protein GLYMA_08G033800 [Glycine max] Length = 320 Score = 54.7 bits (130), Expect = 5e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 3 RNSKDNISIIVVDLKSKRKRQQRPPSIS 86 RNSKDNISIIVVDLKSKRKRQQRPP IS Sbjct: 293 RNSKDNISIIVVDLKSKRKRQQRPPLIS 320 >XP_003525286.1 PREDICTED: probable protein phosphatase 2C 6 [Glycine max] KRH60215.1 hypothetical protein GLYMA_05G227100 [Glycine max] Length = 384 Score = 54.7 bits (130), Expect = 5e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 3 RNSKDNISIIVVDLKSKRKRQQRPPSIS 86 RNSKDNISIIVVDLKSKRKRQQRPP IS Sbjct: 357 RNSKDNISIIVVDLKSKRKRQQRPPLIS 384 >XP_003530510.1 PREDICTED: probable protein phosphatase 2C 6 [Glycine max] KRH41498.1 hypothetical protein GLYMA_08G033800 [Glycine max] Length = 385 Score = 54.7 bits (130), Expect = 5e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 3 RNSKDNISIIVVDLKSKRKRQQRPPSIS 86 RNSKDNISIIVVDLKSKRKRQQRPP IS Sbjct: 358 RNSKDNISIIVVDLKSKRKRQQRPPLIS 385 >XP_014505739.1 PREDICTED: probable protein phosphatase 2C 6 [Vigna radiata var. radiata] Length = 391 Score = 54.7 bits (130), Expect = 5e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 3 RNSKDNISIIVVDLKSKRKRQQRPPSIS 86 RNSKDNISIIVVDLKSKRKRQQRPP IS Sbjct: 364 RNSKDNISIIVVDLKSKRKRQQRPPLIS 391 >XP_007160290.1 hypothetical protein PHAVU_002G309100g [Phaseolus vulgaris] ESW32284.1 hypothetical protein PHAVU_002G309100g [Phaseolus vulgaris] Length = 392 Score = 54.7 bits (130), Expect = 5e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 3 RNSKDNISIIVVDLKSKRKRQQRPPSIS 86 RNSKDNISIIVVDLKSKRKRQQRPP IS Sbjct: 365 RNSKDNISIIVVDLKSKRKRQQRPPLIS 392 >XP_004503481.1 PREDICTED: probable protein phosphatase 2C 6 [Cicer arietinum] Length = 397 Score = 54.3 bits (129), Expect = 7e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 3 RNSKDNISIIVVDLKSKRKRQQRPPSIS 86 RNSKDNISIIVVDLKSKRKR QRPPSIS Sbjct: 370 RNSKDNISIIVVDLKSKRKRLQRPPSIS 397 >GAU11729.1 hypothetical protein TSUD_74800 [Trifolium subterraneum] Length = 230 Score = 53.1 bits (126), Expect = 1e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 3 RNSKDNISIIVVDLKSKRKRQQRPPSIS 86 RNSKDNISIIVVDLK+KRKR QRPPSIS Sbjct: 203 RNSKDNISIIVVDLKTKRKRLQRPPSIS 230 >XP_016188716.1 PREDICTED: probable protein phosphatase 2C 6 [Arachis ipaensis] Length = 398 Score = 52.0 bits (123), Expect = 4e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 3 RNSKDNISIIVVDLKSKRKRQQRPPSIS*EPDSL 104 RNSKDNISIIVVDLKSKRKRQ RPP ++ E + L Sbjct: 365 RNSKDNISIIVVDLKSKRKRQPRPPLVAREANYL 398 >KYP67477.1 putative protein phosphatase 2C 6 [Cajanus cajan] Length = 370 Score = 51.6 bits (122), Expect = 6e-06 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +3 Query: 3 RNSKDNISIIVVDLKSKRKRQQRPPSIS 86 RNSKDNISIIVVDLKSKRKRQQRP IS Sbjct: 343 RNSKDNISIIVVDLKSKRKRQQRPSLIS 370 >XP_017442239.1 PREDICTED: probable protein phosphatase 2C 6 [Vigna angularis] XP_017442241.1 PREDICTED: probable protein phosphatase 2C 6 [Vigna angularis] KOM57836.1 hypothetical protein LR48_Vigan11g086900 [Vigna angularis] BAT72867.1 hypothetical protein VIGAN_01030900 [Vigna angularis var. angularis] Length = 391 Score = 51.6 bits (122), Expect = 6e-06 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +3 Query: 3 RNSKDNISIIVVDLKSKRKRQQRPPSIS 86 RNSKDNISIIVVDLKSKRKRQQRP IS Sbjct: 364 RNSKDNISIIVVDLKSKRKRQQRPALIS 391 >XP_003630720.1 protein phosphatase 2C-like protein [Medicago truncatula] AET05196.1 protein phosphatase 2C-like protein [Medicago truncatula] Length = 402 Score = 51.6 bits (122), Expect = 6e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +3 Query: 3 RNSKDNISIIVVDLKSKRKRQQRPPSIS 86 RNS DN+SIIVVDLKSKRKR QRPPSIS Sbjct: 375 RNSTDNVSIIVVDLKSKRKRVQRPPSIS 402 >XP_015954202.1 PREDICTED: probable protein phosphatase 2C 6 [Arachis duranensis] Length = 398 Score = 51.2 bits (121), Expect = 8e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 3 RNSKDNISIIVVDLKSKRKRQQRPPSIS*E 92 RNSKDNISIIVVDLKSKRKRQ RPP ++ E Sbjct: 365 RNSKDNISIIVVDLKSKRKRQPRPPLVARE 394