BLASTX nr result
ID: Glycyrrhiza32_contig00022273
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00022273 (450 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFK45154.1 unknown [Lotus japonicus] 54 5e-07 XP_003538721.1 PREDICTED: AT-hook motif nuclear-localized protei... 55 6e-06 >AFK45154.1 unknown [Lotus japonicus] Length = 86 Score = 54.3 bits (129), Expect = 5e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 450 APLFHGLNLPPNLLNSVQMPSNETFWPPGHRSPY 349 APLFHGL PPNLLNSVQMP+++ FWP G RSPY Sbjct: 56 APLFHGL--PPNLLNSVQMPNSDNFWPSG-RSPY 86 >XP_003538721.1 PREDICTED: AT-hook motif nuclear-localized protein 24-like [Glycine max] KRH28007.1 hypothetical protein GLYMA_11G028800 [Glycine max] KRH28008.1 hypothetical protein GLYMA_11G028800 [Glycine max] Length = 298 Score = 54.7 bits (130), Expect = 6e-06 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = -1 Query: 450 APLFHGLNLPPNLLNSVQMPSNETFWPPGHRSPY 349 APLFHGLN PNLLNSVQMPS ETFW G RSPY Sbjct: 267 APLFHGLN--PNLLNSVQMPSTETFWATG-RSPY 297