BLASTX nr result
ID: Glycyrrhiza32_contig00022179
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00022179 (488 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013457530.1 two-component response regulator-APRR2-like prote... 78 7e-14 XP_013457531.1 two-component response regulator-APRR2-like prote... 78 7e-14 >XP_013457530.1 two-component response regulator-APRR2-like protein [Medicago truncatula] KEH31561.1 two-component response regulator-APRR2-like protein [Medicago truncatula] Length = 560 Score = 78.2 bits (191), Expect = 7e-14 Identities = 42/68 (61%), Positives = 49/68 (72%), Gaps = 1/68 (1%) Frame = +2 Query: 2 ALSNANAVDYTFGLP-HSSIEHYPVMQYFPFSFFLLVHSGNWQVTSLHILIGAQMSYVVT 178 A+SNANA+DYTF + HSS + YPVMQYFPFSFFLL HS QVTSL+ILI + Sbjct: 478 AVSNANAMDYTFSMMLHSSFDDYPVMQYFPFSFFLLDHSSYMQVTSLYILIRT----ISC 533 Query: 179 CDEIVAQL 202 CDEI+ L Sbjct: 534 CDEIIVLL 541 >XP_013457531.1 two-component response regulator-APRR2-like protein [Medicago truncatula] KEH31562.1 two-component response regulator-APRR2-like protein [Medicago truncatula] Length = 580 Score = 78.2 bits (191), Expect = 7e-14 Identities = 42/68 (61%), Positives = 49/68 (72%), Gaps = 1/68 (1%) Frame = +2 Query: 2 ALSNANAVDYTFGLP-HSSIEHYPVMQYFPFSFFLLVHSGNWQVTSLHILIGAQMSYVVT 178 A+SNANA+DYTF + HSS + YPVMQYFPFSFFLL HS QVTSL+ILI + Sbjct: 498 AVSNANAMDYTFSMMLHSSFDDYPVMQYFPFSFFLLDHSSYMQVTSLYILIRT----ISC 553 Query: 179 CDEIVAQL 202 CDEI+ L Sbjct: 554 CDEIIVLL 561