BLASTX nr result
ID: Glycyrrhiza32_contig00022023
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00022023 (433 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAU00451.1 hypothetical protein VIGAN_10204900 [Vigna angularis ... 54 4e-06 KYP67244.1 Histidine triad nucleotide-binding protein 3 [Cajanus... 52 6e-06 >BAU00451.1 hypothetical protein VIGAN_10204900 [Vigna angularis var. angularis] Length = 182 Score = 53.9 bits (128), Expect = 4e-06 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -2 Query: 366 VDVQICPVQFHDCLLYPVSHMLEVGRMLLLRDAPQSKQYRY 244 V VQ +F D L Y V+HMLEVG+ LLLRDAPQS+QYR+ Sbjct: 85 VCVQFFIFEFRDWLFYSVNHMLEVGKTLLLRDAPQSQQYRF 125 >KYP67244.1 Histidine triad nucleotide-binding protein 3 [Cajanus cajan] Length = 121 Score = 52.4 bits (124), Expect = 6e-06 Identities = 30/57 (52%), Positives = 34/57 (59%), Gaps = 8/57 (14%) Frame = -2 Query: 315 VSHMLEVGRMLLLRDAPQSKQYRYWVAYKLQVLI--------IRFIQDADFNSNCCH 169 VSHMLEVG+ LL RDAPQS+QYRY + L+ IR I DAD N N H Sbjct: 65 VSHMLEVGKTLLHRDAPQSQQYRYLLGCLQLCLLFSACPVCDIRLIHDADLNCNSYH 121