BLASTX nr result
ID: Glycyrrhiza32_contig00021862
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00021862 (249 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018269144.1 hypothetical protein RHOBADRAFT_65476, partial [R... 59 2e-08 KZT60896.1 40s ribosomal protein s6-b [Calocera cornea HHB12733] 57 8e-08 KZO94188.1 ribosomal protein S6e [Calocera viscosa TUFC12733] 57 8e-08 XP_014568628.1 hypothetical protein L969DRAFT_102757 [Mixia osmu... 57 1e-07 KWU45248.1 ribosomal protein S6e [Rhodotorula sp. JG-1b] 56 1e-07 KDE07285.1 40S ribosomal protein S6-B [Microbotryum lychnidis-di... 56 2e-07 XP_016270669.1 40S ribosomal protein s6 [Rhodotorula toruloides ... 56 2e-07 OCB91908.1 hypothetical protein A7U60_g804 [Sanghuangporus baumii] 55 2e-07 EEB92937.1 hypothetical protein MPER_08477 [Moniliophthora perni... 54 2e-07 XP_007270385.1 ribosomal protein S6e [Fomitiporia mediterranea M... 54 6e-07 XP_018282021.1 40s ribosomal protein s6-b [Cutaneotrichosporon o... 54 8e-07 KIY48433.1 ribosomal protein S6e [Fistulina hepatica ATCC 64428] 54 8e-07 XP_014182126.1 hypothetical protein A1Q1_07639 [Trichosporon asa... 54 1e-06 OAJ20401.1 hypothetical protein A4X09_g1774 [Tilletia walkeri] 54 1e-06 OAJ13511.1 hypothetical protein A4X03_g6387 [Tilletia caries] OA... 54 1e-06 OAJ06690.1 hypothetical protein A4X13_g1234 [Tilletia indica] 54 1e-06 KXN82292.1 40S ribosomal protein S6-B [Leucoagaricus sp. SymC.cos] 54 1e-06 XP_006463555.1 hypothetical protein AGABI2DRAFT_194344 [Agaricus... 54 1e-06 KYQ32736.1 40S ribosomal protein S6-B [Hypsizygus marmoreus] 54 2e-06 GAW01712.1 40S ribosomal protein S6 [Lentinula edodes] 53 2e-06 >XP_018269144.1 hypothetical protein RHOBADRAFT_65476, partial [Rhodotorula graminis WP1] KPV73095.1 hypothetical protein RHOBADRAFT_65476, partial [Rhodotorula graminis WP1] Length = 239 Score = 58.5 bits (140), Expect = 2e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 4 YSKAPKIQRLVTPERLQRRRHLRSLKRPKT 93 Y+KAPKIQRLVTPERLQRRRHLRSLKR KT Sbjct: 172 YTKAPKIQRLVTPERLQRRRHLRSLKRRKT 201 >KZT60896.1 40s ribosomal protein s6-b [Calocera cornea HHB12733] Length = 241 Score = 57.0 bits (136), Expect = 8e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 4 YSKAPKIQRLVTPERLQRRRHLRSLKRPKT 93 Y KAPKIQRLVTPERLQRRRHLRSLK+ KT Sbjct: 173 YKKAPKIQRLVTPERLQRRRHLRSLKKRKT 202 >KZO94188.1 ribosomal protein S6e [Calocera viscosa TUFC12733] Length = 241 Score = 57.0 bits (136), Expect = 8e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 4 YSKAPKIQRLVTPERLQRRRHLRSLKRPKT 93 Y KAPKIQRLVTPERLQRRRHLRSLK+ KT Sbjct: 173 YKKAPKIQRLVTPERLQRRRHLRSLKKRKT 202 >XP_014568628.1 hypothetical protein L969DRAFT_102757 [Mixia osmundae IAM 14324] GAA99394.1 hypothetical protein E5Q_06091 [Mixia osmundae IAM 14324] KEI40026.1 hypothetical protein L969DRAFT_102757 [Mixia osmundae IAM 14324] Length = 733 Score = 57.4 bits (137), Expect = 1e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 4 YSKAPKIQRLVTPERLQRRRHLRSLKRPKT 93 Y+KAPKIQRLVTPERLQRRRHLRSL+R KT Sbjct: 656 YTKAPKIQRLVTPERLQRRRHLRSLRRRKT 685 >KWU45248.1 ribosomal protein S6e [Rhodotorula sp. JG-1b] Length = 234 Score = 56.2 bits (134), Expect = 1e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 4 YSKAPKIQRLVTPERLQRRRHLRSLKRPKT 93 Y+KAPKIQRLVTPERLQRRRHLRSL R KT Sbjct: 172 YTKAPKIQRLVTPERLQRRRHLRSLARRKT 201 >KDE07285.1 40S ribosomal protein S6-B [Microbotryum lychnidis-dioicae p1A1 Lamole] Length = 238 Score = 56.2 bits (134), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 4 YSKAPKIQRLVTPERLQRRRHLRSLKRPKT 93 Y+KAPKIQRLVTPERLQRRRH RSLKR KT Sbjct: 172 YTKAPKIQRLVTPERLQRRRHQRSLKRRKT 201 >XP_016270669.1 40S ribosomal protein s6 [Rhodotorula toruloides NP11] EMS19550.1 40S ribosomal protein s6 [Rhodotorula toruloides NP11] CDR48807.1 RHTO0S20e01816g1_1 [Rhodotorula toruloides] Length = 238 Score = 56.2 bits (134), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 4 YSKAPKIQRLVTPERLQRRRHLRSLKRPKT 93 Y+KAPKIQRLVTP RLQRRRHLRSLKR KT Sbjct: 172 YTKAPKIQRLVTPTRLQRRRHLRSLKRRKT 201 >OCB91908.1 hypothetical protein A7U60_g804 [Sanghuangporus baumii] Length = 207 Score = 55.5 bits (132), Expect = 2e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 4 YSKAPKIQRLVTPERLQRRRHLRSLKR 84 Y+KAPKIQRLVTPERLQRRRHLRSLKR Sbjct: 141 YTKAPKIQRLVTPERLQRRRHLRSLKR 167 >EEB92937.1 hypothetical protein MPER_08477 [Moniliophthora perniciosa FA553] Length = 120 Score = 53.9 bits (128), Expect = 2e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +1 Query: 4 YSKAPKIQRLVTPERLQRRRHLRSLKRPK 90 Y+KAPKIQRLVTP RLQRRRHLRSLKR K Sbjct: 52 YTKAPKIQRLVTPVRLQRRRHLRSLKRRK 80 >XP_007270385.1 ribosomal protein S6e [Fomitiporia mediterranea MF3/22] EJC99152.1 ribosomal protein S6e [Fomitiporia mediterranea MF3/22] Length = 212 Score = 54.3 bits (129), Expect = 6e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 4 YSKAPKIQRLVTPERLQRRRHLRSLKR 84 Y+KAPKIQRLVTP+RLQRRRHLRSLKR Sbjct: 172 YTKAPKIQRLVTPQRLQRRRHLRSLKR 198 >XP_018282021.1 40s ribosomal protein s6-b [Cutaneotrichosporon oleaginosus] KLT45530.1 40s ribosomal protein s6-b [Cutaneotrichosporon oleaginosus] Length = 238 Score = 54.3 bits (129), Expect = 8e-07 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = +1 Query: 1 TYSKAPKIQRLVTPERLQRRRHLRSLKRPKT 93 TY+KAPKIQRLVTP+RLQR+RHLRSLK+ ++ Sbjct: 169 TYTKAPKIQRLVTPQRLQRKRHLRSLKKRRS 199 >KIY48433.1 ribosomal protein S6e [Fistulina hepatica ATCC 64428] Length = 238 Score = 54.3 bits (129), Expect = 8e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +1 Query: 4 YSKAPKIQRLVTPERLQRRRHLRSLKRPK 90 Y+KAPKIQRL+TPERLQRRRHLR++KR K Sbjct: 172 YTKAPKIQRLITPERLQRRRHLRAIKRRK 200 >XP_014182126.1 hypothetical protein A1Q1_07639 [Trichosporon asahii var. asahii CBS 2479] EJT51175.1 hypothetical protein A1Q1_07639 [Trichosporon asahii var. asahii CBS 2479] EKC98267.1 hypothetical protein A1Q2_07281 [Trichosporon asahii var. asahii CBS 8904] Length = 235 Score = 53.9 bits (128), Expect = 1e-06 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = +1 Query: 1 TYSKAPKIQRLVTPERLQRRRHLRSLKR 84 TY+KAPKIQRLVTP+RLQR+RHLRSLK+ Sbjct: 169 TYTKAPKIQRLVTPQRLQRKRHLRSLKK 196 >OAJ20401.1 hypothetical protein A4X09_g1774 [Tilletia walkeri] Length = 238 Score = 53.9 bits (128), Expect = 1e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +1 Query: 4 YSKAPKIQRLVTPERLQRRRHLRSLKRPKT 93 Y+KAPKIQRLVTPER+QRRRHLRSLK+ ++ Sbjct: 171 YTKAPKIQRLVTPERIQRRRHLRSLKKRRS 200 >OAJ13511.1 hypothetical protein A4X03_g6387 [Tilletia caries] OAJ32685.1 hypothetical protein A4X06_g39 [Tilletia controversa] Length = 241 Score = 53.9 bits (128), Expect = 1e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +1 Query: 4 YSKAPKIQRLVTPERLQRRRHLRSLKRPKT 93 Y+KAPKIQRLVTPER+QRRRHLRSLK+ ++ Sbjct: 174 YTKAPKIQRLVTPERIQRRRHLRSLKKRRS 203 >OAJ06690.1 hypothetical protein A4X13_g1234 [Tilletia indica] Length = 241 Score = 53.9 bits (128), Expect = 1e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +1 Query: 4 YSKAPKIQRLVTPERLQRRRHLRSLKRPKT 93 Y+KAPKIQRLVTPER+QRRRHLRSLK+ ++ Sbjct: 174 YTKAPKIQRLVTPERIQRRRHLRSLKKRRS 203 >KXN82292.1 40S ribosomal protein S6-B [Leucoagaricus sp. SymC.cos] Length = 238 Score = 53.5 bits (127), Expect = 1e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = +1 Query: 4 YSKAPKIQRLVTPERLQRRRHLRSLKR 84 Y+KAPKIQRLVTP+RLQRRRHLRS+KR Sbjct: 173 YTKAPKIQRLVTPQRLQRRRHLRSIKR 199 >XP_006463555.1 hypothetical protein AGABI2DRAFT_194344 [Agaricus bisporus var. bisporus H97] XP_007334012.1 hypothetical protein AGABI1DRAFT_80049 [Agaricus bisporus var. burnettii JB137-S8] EKM75311.1 hypothetical protein AGABI1DRAFT_80049 [Agaricus bisporus var. burnettii JB137-S8] EKV45412.1 hypothetical protein AGABI2DRAFT_194344 [Agaricus bisporus var. bisporus H97] Length = 238 Score = 53.5 bits (127), Expect = 1e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +1 Query: 4 YSKAPKIQRLVTPERLQRRRHLRSLKRPK 90 Y+KAPKIQRLVTP RLQRRRHLRSLKR K Sbjct: 173 YTKAPKIQRLVTPLRLQRRRHLRSLKRRK 201 >KYQ32736.1 40S ribosomal protein S6-B [Hypsizygus marmoreus] Length = 240 Score = 53.5 bits (127), Expect = 2e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +1 Query: 4 YSKAPKIQRLVTPERLQRRRHLRSLKRPK 90 Y+KAPKIQRLVTP RLQRRRHLRSLKR K Sbjct: 173 YTKAPKIQRLVTPLRLQRRRHLRSLKRRK 201 >GAW01712.1 40S ribosomal protein S6 [Lentinula edodes] Length = 218 Score = 53.1 bits (126), Expect = 2e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 4 YSKAPKIQRLVTPERLQRRRHLRSLKRPK 90 Y+KAPKIQRLVTP RLQRRRHLRS+KR K Sbjct: 153 YTKAPKIQRLVTPMRLQRRRHLRSIKRRK 181