BLASTX nr result
ID: Glycyrrhiza32_contig00021741
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00021741 (203 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015933687.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 2e-09 XP_016167865.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 62 2e-09 GAU11017.1 hypothetical protein TSUD_113100 [Trifolium subterran... 59 1e-08 XP_004486725.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 7e-08 XP_017423149.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 8e-07 XP_019436424.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 1e-06 XP_014498630.1 PREDICTED: pentatricopeptide repeat-containing pr... 52 5e-06 >XP_015933687.1 PREDICTED: pentatricopeptide repeat-containing protein At3g16010 [Arachis duranensis] Length = 607 Score = 61.6 bits (148), Expect = 2e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 104 MLAGSIARRRRISTWPPFSQRIKQTENEIVQMF 202 ML+GS+A R+ISTWPPFSQRIKQTENEIVQMF Sbjct: 1 MLSGSLATTRKISTWPPFSQRIKQTENEIVQMF 33 >XP_016167865.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g16010 [Arachis ipaensis] Length = 622 Score = 61.6 bits (148), Expect = 2e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 104 MLAGSIARRRRISTWPPFSQRIKQTENEIVQMF 202 ML+GS+A R+ISTWPPFSQRIKQTENEIVQMF Sbjct: 1 MLSGSLATTRKISTWPPFSQRIKQTENEIVQMF 33 >GAU11017.1 hypothetical protein TSUD_113100 [Trifolium subterraneum] Length = 639 Score = 59.3 bits (142), Expect = 1e-08 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 104 MLAGSIARRRRISTWPPFSQRIKQTENEIVQMF 202 M +GS+ RR ISTWPPFSQR+KQTENEIVQMF Sbjct: 1 MFSGSVVTRRMISTWPPFSQRLKQTENEIVQMF 33 >XP_004486725.1 PREDICTED: pentatricopeptide repeat-containing protein At3g16010 [Cicer arietinum] Length = 638 Score = 57.0 bits (136), Expect = 7e-08 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +2 Query: 104 MLAGSIARRRRISTWPPFSQRIKQTENEIVQMF 202 ML IA RR ISTWPPFSQR+KQTENEIVQMF Sbjct: 1 MLPRFIASRRNISTWPPFSQRLKQTENEIVQMF 33 >XP_017423149.1 PREDICTED: pentatricopeptide repeat-containing protein At3g16010 isoform X2 [Vigna angularis] KOM44538.1 hypothetical protein LR48_Vigan05g214300 [Vigna angularis] BAT91587.1 hypothetical protein VIGAN_07019500 [Vigna angularis var. angularis] Length = 640 Score = 53.9 bits (128), Expect = 8e-07 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 1/34 (2%) Frame = +2 Query: 104 MLAGSIARRRR-ISTWPPFSQRIKQTENEIVQMF 202 ML GSIA RR IST+PPFSQR+KQTENEIVQMF Sbjct: 1 MLGGSIAATRRGISTFPPFSQRLKQTENEIVQMF 34 >XP_019436424.1 PREDICTED: pentatricopeptide repeat-containing protein At3g16010 [Lupinus angustifolius] Length = 648 Score = 53.5 bits (127), Expect = 1e-06 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = +2 Query: 122 ARRRRISTWPPFSQRIKQTENEIVQMF 202 +R R+ISTWPPFSQR+KQTENEIVQMF Sbjct: 15 SRSRKISTWPPFSQRLKQTENEIVQMF 41 >XP_014498630.1 PREDICTED: pentatricopeptide repeat-containing protein At3g16010 isoform X2 [Vigna radiata var. radiata] Length = 640 Score = 51.6 bits (122), Expect = 5e-06 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 1/34 (2%) Frame = +2 Query: 104 MLAGSIARRRR-ISTWPPFSQRIKQTENEIVQMF 202 ML GS+A RR IST+PPF QR+KQTENEIVQMF Sbjct: 1 MLGGSVAATRRGISTFPPFCQRLKQTENEIVQMF 34