BLASTX nr result
ID: Glycyrrhiza32_contig00021396
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00021396 (214 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SFM51476.1 Site-specific recombinase XerD [Bradyrhizobium sp. Rc3b] 70 1e-12 WP_026201708.1 integrase [Bradyrhizobium sp. WSM2793] 70 1e-12 WP_069277357.1 integrase [Bradyrhizobium elkanii] ODM79587.1 int... 68 1e-11 WP_038379810.1 integrase [Bradyrhizobium elkanii] 67 1e-11 WP_057834195.1 integrase [Bradyrhizobium jicamae] KRR13331.1 int... 60 6e-09 WP_028344528.1 integrase [Bradyrhizobium elkanii] 58 4e-08 WP_028167090.1 hypothetical protein [Bradyrhizobium elkanii] 55 1e-07 >SFM51476.1 Site-specific recombinase XerD [Bradyrhizobium sp. Rc3b] Length = 365 Score = 70.5 bits (171), Expect = 1e-12 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 1/47 (2%) Frame = -3 Query: 212 KSEYVANTFNRRRDAEEWAIDIERAIDRGFPIRRSRPL-TPRLASGI 75 K+EY+ANTF RRRDAEEWA+D+ER+IDRG PIRRSRP PR+ S + Sbjct: 19 KNEYIANTFVRRRDAEEWALDVERSIDRGTPIRRSRPFEQPRIFSDL 65 Score = 58.2 bits (139), Expect = 3e-08 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +3 Query: 3 RTATIRDRKDPRRKDGNHQTVPLLNSTG 86 RT TIRDRKDPRRKDGNHQ VPLLNSTG Sbjct: 227 RTVTIRDRKDPRRKDGNHQVVPLLNSTG 254 >WP_026201708.1 integrase [Bradyrhizobium sp. WSM2793] Length = 365 Score = 70.5 bits (171), Expect = 1e-12 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 1/47 (2%) Frame = -3 Query: 212 KSEYVANTFNRRRDAEEWAIDIERAIDRGFPIRRSRPL-TPRLASGI 75 K+EY+ANTF RRRDAEEWA+D+ER+IDRG PIRRSRP PR+ S + Sbjct: 19 KNEYIANTFVRRRDAEEWALDVERSIDRGTPIRRSRPFEQPRIFSDL 65 Score = 58.2 bits (139), Expect = 3e-08 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +3 Query: 3 RTATIRDRKDPRRKDGNHQTVPLLNSTG 86 RT TIRDRKDPRRKDGNHQ VPLLNSTG Sbjct: 227 RTVTIRDRKDPRRKDGNHQVVPLLNSTG 254 >WP_069277357.1 integrase [Bradyrhizobium elkanii] ODM79587.1 integrase [Bradyrhizobium elkanii] ODM81397.1 integrase [Bradyrhizobium elkanii] Length = 365 Score = 67.8 bits (164), Expect = 1e-11 Identities = 34/47 (72%), Positives = 39/47 (82%), Gaps = 1/47 (2%) Frame = -3 Query: 212 KSEYVANTFNRRRDAEEWAIDIERAIDRGFPIRRSRPL-TPRLASGI 75 K+EYVANTF RRRDAEEWAID+ER+IDRG PIRRSR PR+ S + Sbjct: 19 KNEYVANTFIRRRDAEEWAIDVERSIDRGTPIRRSRSREQPRIFSDL 65 Score = 56.2 bits (134), Expect = 1e-07 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +3 Query: 3 RTATIRDRKDPRRKDGNHQTVPLLNSTG 86 RT TIRDRKDPRRK+GNHQ VPLLNSTG Sbjct: 227 RTVTIRDRKDPRRKEGNHQIVPLLNSTG 254 >WP_038379810.1 integrase [Bradyrhizobium elkanii] Length = 365 Score = 67.4 bits (163), Expect = 1e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 212 KSEYVANTFNRRRDAEEWAIDIERAIDRGFPIRRSR 105 K+EYVANTF RRRDAEEWAID+ER+IDRG PIRRSR Sbjct: 19 KNEYVANTFIRRRDAEEWAIDVERSIDRGTPIRRSR 54 Score = 57.8 bits (138), Expect = 4e-08 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +3 Query: 3 RTATIRDRKDPRRKDGNHQTVPLLNSTG 86 RT TIRDRKDPRRKDGNHQ VPLLNSTG Sbjct: 227 RTVTIRDRKDPRRKDGNHQIVPLLNSTG 254 >WP_057834195.1 integrase [Bradyrhizobium jicamae] KRR13331.1 integrase [Bradyrhizobium jicamae] Length = 365 Score = 60.1 bits (144), Expect = 6e-09 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 212 KSEYVANTFNRRRDAEEWAIDIERAIDRGFPIRRSRP 102 K +YVANTF RRRDAEEWAI+ ER+IDRG P RSRP Sbjct: 19 KRQYVANTFIRRRDAEEWAIEAERSIDRGRPAPRSRP 55 Score = 57.4 bits (137), Expect = 5e-08 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +3 Query: 3 RTATIRDRKDPRRKDGNHQTVPLLNSTG 86 RT T+RDRKDPRRKDGNHQ VPLLNSTG Sbjct: 227 RTVTVRDRKDPRRKDGNHQIVPLLNSTG 254 >WP_028344528.1 integrase [Bradyrhizobium elkanii] Length = 365 Score = 57.8 bits (138), Expect = 4e-08 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +3 Query: 3 RTATIRDRKDPRRKDGNHQTVPLLNSTG 86 RT TIRDRKDPRRKDGNHQ VPLLNSTG Sbjct: 227 RTVTIRDRKDPRRKDGNHQKVPLLNSTG 254 Score = 57.4 bits (137), Expect = 5e-08 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -3 Query: 212 KSEYVANTFNRRRDAEEWAIDIERAIDRGFPIRRSR 105 K +Y+ANTF RRRDAEEWAI+ ER+IDRG +RRS+ Sbjct: 19 KRQYIANTFIRRRDAEEWAIEAERSIDRGTAVRRSK 54 >WP_028167090.1 hypothetical protein [Bradyrhizobium elkanii] Length = 147 Score = 54.7 bits (130), Expect = 1e-07 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +3 Query: 3 RTATIRDRKDPRRKDGNHQTVPLLNSTG 86 RT TIRDRKDPRRKDGN Q VPLLNSTG Sbjct: 19 RTVTIRDRKDPRRKDGNDQVVPLLNSTG 46