BLASTX nr result
ID: Glycyrrhiza32_contig00021188
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00021188 (254 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU26239.1 hypothetical protein TSUD_224300 [Trifolium subterran... 53 4e-06 >GAU26239.1 hypothetical protein TSUD_224300 [Trifolium subterraneum] Length = 1250 Score = 52.8 bits (125), Expect = 4e-06 Identities = 25/82 (30%), Positives = 39/82 (47%) Frame = -2 Query: 253 WSDVWIPSLGKLEHLIQRPLSTMERFLTVANLGDNQGGWNLGAFDDVLSAGTIQKIISMT 74 W D W+P +G L +++ R + +V+ D G W F+D + QKI + Sbjct: 820 WLDNWVPKVGPLINVVNRDVPASNSNNSVSMFVDQNGDWQKDLFEDFIPFSVQQKIYGLI 879 Query: 73 GLRTDKGDDSVVWSRTTDG*FS 8 R G D++ W T+DG FS Sbjct: 880 PPRVCMGSDTLAWGCTSDGRFS 901