BLASTX nr result
ID: Glycyrrhiza32_contig00020871
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00020871 (596 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KJB33437.1 hypothetical protein B456_006G011100 [Gossypium raimo... 78 2e-14 KHG26758.1 Biotin carboxyl carrier of acetyl-CoA carboxylase 2, ... 79 2e-14 XP_003618716.1 biotin carboxyl carrier acetyl-CoA carboxylase [M... 79 2e-14 XP_017610839.1 PREDICTED: biotin carboxyl carrier protein of ace... 79 2e-14 KJB33436.1 hypothetical protein B456_006G011100 [Gossypium raimo... 78 3e-14 KDP27226.1 hypothetical protein JCGZ_19925 [Jatropha curcas] 79 3e-14 OAY60239.1 hypothetical protein MANES_01G097500 [Manihot esculenta] 79 3e-14 KJB33439.1 hypothetical protein B456_006G011100 [Gossypium raimo... 78 3e-14 XP_015879793.1 PREDICTED: biotin carboxyl carrier protein of ace... 79 4e-14 XP_007029252.1 PREDICTED: biotin carboxyl carrier protein of ace... 79 4e-14 NP_001241523.1 uncharacterized protein LOC100777962 [Glycine max... 79 4e-14 XP_015879792.1 PREDICTED: biotin carboxyl carrier protein of ace... 79 4e-14 KJB66287.1 hypothetical protein B456_010G135200 [Gossypium raimo... 76 6e-14 AFS89700.1 biotin carboxyl carrier protein [Vernicia fordii] 78 6e-14 EOY09756.1 Biotin carboxyl carrier protein subunit of of Het-ACC... 79 6e-14 XP_012483505.1 PREDICTED: biotin carboxyl carrier protein of ace... 78 6e-14 AFP99173.1 biotin carboxyl carrier protein [Vernicia fordii] 78 7e-14 NP_001295674.1 biotin carboxyl carrier protein of acetyl-CoA car... 78 7e-14 XP_008379410.1 PREDICTED: biotin carboxyl carrier protein of ace... 78 8e-14 XP_012460343.1 PREDICTED: biotin carboxyl carrier protein of ace... 78 9e-14 >KJB33437.1 hypothetical protein B456_006G011100 [Gossypium raimondii] KJB33438.1 hypothetical protein B456_006G011100 [Gossypium raimondii] Length = 201 Score = 78.2 bits (191), Expect = 2e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 1 CIIEAMKLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 126 CIIEAMKLMNEIEADQSGTI EIL EDGK+V+VDMPLFVIVP Sbjct: 160 CIIEAMKLMNEIEADQSGTITEILAEDGKAVSVDMPLFVIVP 201 >KHG26758.1 Biotin carboxyl carrier of acetyl-CoA carboxylase 2, chloroplastic -like protein [Gossypium arboreum] Length = 270 Score = 79.3 bits (194), Expect = 2e-14 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 1 CIIEAMKLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 126 CIIEAMKLMNEIEADQSGTI EIL EDGKSV+VDMPLFVIVP Sbjct: 229 CIIEAMKLMNEIEADQSGTITEILAEDGKSVSVDMPLFVIVP 270 >XP_003618716.1 biotin carboxyl carrier acetyl-CoA carboxylase [Medicago truncatula] AES74934.1 biotin carboxyl carrier acetyl-CoA carboxylase [Medicago truncatula] Length = 278 Score = 79.3 bits (194), Expect = 2e-14 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +1 Query: 1 CIIEAMKLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 126 CIIEAMKLMNEIEADQSGTIAEILVEDGK V+VD+PLFVIVP Sbjct: 237 CIIEAMKLMNEIEADQSGTIAEILVEDGKPVSVDLPLFVIVP 278 >XP_017610839.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic [Gossypium arboreum] Length = 284 Score = 79.3 bits (194), Expect = 2e-14 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 1 CIIEAMKLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 126 CIIEAMKLMNEIEADQSGTI EIL EDGKSV+VDMPLFVIVP Sbjct: 243 CIIEAMKLMNEIEADQSGTITEILAEDGKSVSVDMPLFVIVP 284 >KJB33436.1 hypothetical protein B456_006G011100 [Gossypium raimondii] Length = 226 Score = 78.2 bits (191), Expect = 3e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 1 CIIEAMKLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 126 CIIEAMKLMNEIEADQSGTI EIL EDGK+V+VDMPLFVIVP Sbjct: 185 CIIEAMKLMNEIEADQSGTITEILAEDGKAVSVDMPLFVIVP 226 >KDP27226.1 hypothetical protein JCGZ_19925 [Jatropha curcas] Length = 270 Score = 79.0 bits (193), Expect = 3e-14 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 1 CIIEAMKLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 126 CIIEAMKLMNEIEADQSGTIAEILVEDGK V+VDMPLFVI P Sbjct: 229 CIIEAMKLMNEIEADQSGTIAEILVEDGKPVSVDMPLFVIAP 270 >OAY60239.1 hypothetical protein MANES_01G097500 [Manihot esculenta] Length = 271 Score = 79.0 bits (193), Expect = 3e-14 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 1 CIIEAMKLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 126 CIIEAMKLMNEIEADQSGTIAEILVEDGK V+VDMPLFVI P Sbjct: 230 CIIEAMKLMNEIEADQSGTIAEILVEDGKPVSVDMPLFVIAP 271 >KJB33439.1 hypothetical protein B456_006G011100 [Gossypium raimondii] Length = 233 Score = 78.2 bits (191), Expect = 3e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 1 CIIEAMKLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 126 CIIEAMKLMNEIEADQSGTI EIL EDGK+V+VDMPLFVIVP Sbjct: 192 CIIEAMKLMNEIEADQSGTITEILAEDGKAVSVDMPLFVIVP 233 >XP_015879793.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic isoform X2 [Ziziphus jujuba] Length = 267 Score = 78.6 bits (192), Expect = 4e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 1 CIIEAMKLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 126 CIIEAMKLMNEIEADQSGT+ EILVEDGK V+VDMPLFVIVP Sbjct: 226 CIIEAMKLMNEIEADQSGTVTEILVEDGKPVSVDMPLFVIVP 267 >XP_007029252.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic isoform X1 [Theobroma cacao] EOY09754.1 Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 1 [Theobroma cacao] Length = 279 Score = 78.6 bits (192), Expect = 4e-14 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 1 CIIEAMKLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 126 CIIEAMKLMNEIEADQSGTI EILVEDGKSV+VDMPLFVI P Sbjct: 238 CIIEAMKLMNEIEADQSGTIVEILVEDGKSVSVDMPLFVIEP 279 >NP_001241523.1 uncharacterized protein LOC100777962 [Glycine max] ACU23332.1 unknown [Glycine max] KRG93630.1 hypothetical protein GLYMA_19G028800 [Glycine max] Length = 280 Score = 78.6 bits (192), Expect = 4e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 1 CIIEAMKLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 126 CIIEAMKLMNEIEADQSGTIAE+L EDGK V+VDMPLFVIVP Sbjct: 239 CIIEAMKLMNEIEADQSGTIAEVLAEDGKPVSVDMPLFVIVP 280 >XP_015879792.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic isoform X1 [Ziziphus jujuba] Length = 282 Score = 78.6 bits (192), Expect = 4e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 1 CIIEAMKLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 126 CIIEAMKLMNEIEADQSGT+ EILVEDGK V+VDMPLFVIVP Sbjct: 241 CIIEAMKLMNEIEADQSGTVTEILVEDGKPVSVDMPLFVIVP 282 >KJB66287.1 hypothetical protein B456_010G135200 [Gossypium raimondii] Length = 161 Score = 75.9 bits (185), Expect = 6e-14 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +1 Query: 1 CIIEAMKLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 126 CIIEAMKLMNEIEADQSGTI EIL EDGK+V+VDMPLFVI P Sbjct: 120 CIIEAMKLMNEIEADQSGTIVEILAEDGKAVSVDMPLFVIEP 161 >AFS89700.1 biotin carboxyl carrier protein [Vernicia fordii] Length = 252 Score = 77.8 bits (190), Expect = 6e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 1 CIIEAMKLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 126 CIIEAMKLMNEIEADQSGTIAEILVEDGK V+VD+PLFVI P Sbjct: 211 CIIEAMKLMNEIEADQSGTIAEILVEDGKPVSVDLPLFVIAP 252 >EOY09756.1 Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 3 [Theobroma cacao] Length = 310 Score = 78.6 bits (192), Expect = 6e-14 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 1 CIIEAMKLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 126 CIIEAMKLMNEIEADQSGTI EILVEDGKSV+VDMPLFVI P Sbjct: 269 CIIEAMKLMNEIEADQSGTIVEILVEDGKSVSVDMPLFVIEP 310 >XP_012483505.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic [Gossypium raimondii] KJB33440.1 hypothetical protein B456_006G011100 [Gossypium raimondii] Length = 284 Score = 78.2 bits (191), Expect = 6e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 1 CIIEAMKLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 126 CIIEAMKLMNEIEADQSGTI EIL EDGK+V+VDMPLFVIVP Sbjct: 243 CIIEAMKLMNEIEADQSGTITEILAEDGKAVSVDMPLFVIVP 284 >AFP99173.1 biotin carboxyl carrier protein [Vernicia fordii] Length = 270 Score = 77.8 bits (190), Expect = 7e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 1 CIIEAMKLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 126 CIIEAMKLMNEIEADQSGTIAEILVEDGK V+VD+PLFVI P Sbjct: 229 CIIEAMKLMNEIEADQSGTIAEILVEDGKPVSVDLPLFVIAP 270 >NP_001295674.1 biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic [Jatropha curcas] ACT33948.1 biotin carboxyl carrier protein subunit [Jatropha curcas] Length = 270 Score = 77.8 bits (190), Expect = 7e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 1 CIIEAMKLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 126 CIIEAMKLMNEIEADQ+GTIAEILVEDGK V+VDMPLFVI P Sbjct: 229 CIIEAMKLMNEIEADQAGTIAEILVEDGKPVSVDMPLFVIAP 270 >XP_008379410.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic [Malus domestica] Length = 278 Score = 77.8 bits (190), Expect = 8e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 1 CIIEAMKLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIVP 126 CIIEAMKLMNEIEADQSGT+AEILVEDGK V+VD PLFVIVP Sbjct: 237 CIIEAMKLMNEIEADQSGTVAEILVEDGKPVSVDTPLFVIVP 278 >XP_012460343.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like [Gossypium raimondii] KJB75633.1 hypothetical protein B456_012G049400 [Gossypium raimondii] Length = 290 Score = 77.8 bits (190), Expect = 9e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +1 Query: 1 CIIEAMKLMNEIEADQSGTIAEILVEDGKSVTVDMPLFVIV 123 CIIEAMKLMNEIEADQSGT+ EILVEDGKSV+VDMPLFVIV Sbjct: 249 CIIEAMKLMNEIEADQSGTVTEILVEDGKSVSVDMPLFVIV 289