BLASTX nr result
ID: Glycyrrhiza32_contig00020703
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00020703 (391 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH00106.1 hypothetical protein GLYMA_18G193500 [Glycine max] 65 2e-11 KJB09775.1 hypothetical protein B456_001G164300 [Gossypium raimo... 59 4e-08 CBI38148.3 unnamed protein product, partial [Vitis vinifera] 43 4e-07 >KRH00106.1 hypothetical protein GLYMA_18G193500 [Glycine max] Length = 68 Score = 64.7 bits (156), Expect = 2e-11 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 390 FFPSGKNEMHRGPSFCCVAACSSDLRIRRG 301 F PSGKNEMHRGPSFCCV ACSSDLRIRRG Sbjct: 32 FSPSGKNEMHRGPSFCCVGACSSDLRIRRG 61 >KJB09775.1 hypothetical protein B456_001G164300 [Gossypium raimondii] Length = 174 Score = 58.5 bits (140), Expect = 4e-08 Identities = 42/105 (40%), Positives = 43/105 (40%) Frame = -3 Query: 383 LPERMKCIGDHPFVVLRHAPQIYGFAGGLRPYLVD*Q*QRLAKLSRAF*IES*VVYQWCK 204 L ERMKCIGDHPFV Sbjct: 122 LGERMKCIGDHPFV---------------------------------------------- 135 Query: 203 AALCPFSVGERIRP*KVSEQRFFYVGMAFPLDSPNVELSDFVTFA 69 A C + R P QRFFYVGMAFPLD PNVELSDFVTFA Sbjct: 136 -AACSSDLRIRRGP-----QRFFYVGMAFPLDFPNVELSDFVTFA 174 >CBI38148.3 unnamed protein product, partial [Vitis vinifera] Length = 288 Score = 43.1 bits (100), Expect(3) = 4e-07 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = +2 Query: 221 LLKIQFKRPYLVSQAFVIVSQLSRA 295 LL IQFKRPYLVSQAFVI ++LSRA Sbjct: 218 LLNIQFKRPYLVSQAFVIFNKLSRA 242 Score = 29.6 bits (65), Expect(3) = 4e-07 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +3 Query: 297 EAPCESVNLRSMPQ 338 EA CES+NLRSMPQ Sbjct: 243 EASCESINLRSMPQ 256 Score = 27.7 bits (60), Expect(3) = 4e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +1 Query: 346 KGWSPMHFILSGREK 390 KGW+ MHFIL GR K Sbjct: 258 KGWTHMHFILIGRGK 272