BLASTX nr result
ID: Glycyrrhiza32_contig00020443
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00020443 (230 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EEF26979.1 conserved hypothetical protein [Ricinus communis] 92 4e-23 >EEF26979.1 conserved hypothetical protein [Ricinus communis] Length = 74 Score = 92.4 bits (228), Expect = 4e-23 Identities = 44/55 (80%), Positives = 47/55 (85%) Frame = -1 Query: 170 EGNKKSIDKIPYRPTGLYVWVLFHLKLGLGRVPLNYR*IIINNTKKEMDSPDSNK 6 +G KKSI+KIP RPTGLYVWVLFHLKLGLGRVP YR IIINNT+KEMDSP K Sbjct: 15 KGGKKSIEKIPSRPTGLYVWVLFHLKLGLGRVPFFYRSIIINNTRKEMDSPAGEK 69