BLASTX nr result
ID: Glycyrrhiza32_contig00019977
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00019977 (201 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU12504.1 hypothetical protein TSUD_377550 [Trifolium subterran... 119 1e-29 XP_010098161.1 hypothetical protein L484_026295 [Morus notabilis... 111 5e-27 XP_004486474.1 PREDICTED: pentatricopeptide repeat-containing pr... 110 1e-26 XP_015959359.1 PREDICTED: pentatricopeptide repeat-containing pr... 108 7e-26 KOM53147.1 hypothetical protein LR48_Vigan09g180600 [Vigna angul... 103 8e-26 XP_003594555.1 PPR containing plant-like protein [Medicago trunc... 105 4e-25 XP_008228402.1 PREDICTED: pentatricopeptide repeat-containing pr... 105 8e-25 XP_007215014.1 hypothetical protein PRUPE_ppa002515mg [Prunus pe... 105 8e-25 XP_017433996.1 PREDICTED: pentatricopeptide repeat-containing pr... 103 2e-24 XP_014517084.1 PREDICTED: pentatricopeptide repeat-containing pr... 103 2e-24 XP_007147463.1 hypothetical protein PHAVU_006G126800g [Phaseolus... 103 3e-24 XP_009344487.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 2e-23 XP_008380840.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 2e-23 XP_006597666.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 3e-23 XP_004305254.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 3e-23 XP_015880442.1 PREDICTED: pentatricopeptide repeat-containing pr... 99 7e-23 GAV75922.1 LOW QUALITY PROTEIN: PPR domain-containing protein/Ac... 98 3e-22 KDO51842.1 hypothetical protein CISIN_1g0413311mg, partial [Citr... 93 1e-21 XP_006426850.1 hypothetical protein CICLE_v10025103mg [Citrus cl... 95 4e-21 XP_010062550.1 PREDICTED: pentatricopeptide repeat-containing pr... 95 4e-21 >GAU12504.1 hypothetical protein TSUD_377550 [Trifolium subterraneum] Length = 647 Score = 119 bits (297), Expect = 1e-29 Identities = 57/67 (85%), Positives = 60/67 (89%) Frame = +1 Query: 1 FHFRFRRHFATKYTAKITSTSPTGRSLAAEVTPPPPLPYDVRGYPLPRRDLICKATQILL 180 FH FRRHFATKYTAKITSTSPTGRSLAAEVTPPPPLP D+RGY LPRRDLICKATQILL Sbjct: 4 FHSNFRRHFATKYTAKITSTSPTGRSLAAEVTPPPPLPSDIRGYSLPRRDLICKATQILL 63 Query: 181 SHSHSHS 201 S ++ S Sbjct: 64 SATNPRS 70 >XP_010098161.1 hypothetical protein L484_026295 [Morus notabilis] EXB74598.1 hypothetical protein L484_026295 [Morus notabilis] Length = 656 Score = 111 bits (277), Expect = 5e-27 Identities = 53/62 (85%), Positives = 57/62 (91%) Frame = +1 Query: 16 RRHFATKYTAKITSTSPTGRSLAAEVTPPPPLPYDVRGYPLPRRDLICKATQILLSHSHS 195 RRH+ATKYTAKITSTSPTGRSL+AEVTPPPPLP DVRGYPLPRRDL+CKAT+ILL S S Sbjct: 20 RRHYATKYTAKITSTSPTGRSLSAEVTPPPPLPSDVRGYPLPRRDLVCKATRILLRQSPS 79 Query: 196 HS 201 S Sbjct: 80 AS 81 >XP_004486474.1 PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Cicer arietinum] Length = 664 Score = 110 bits (274), Expect = 1e-26 Identities = 53/60 (88%), Positives = 56/60 (93%) Frame = +1 Query: 4 HFRFRRHFATKYTAKITSTSPTGRSLAAEVTPPPPLPYDVRGYPLPRRDLICKATQILLS 183 +++FRRH ATKYTAKITSTSPTGRSLAAEVTPP PLP DVRGY LPRRDLICKATQILLS Sbjct: 23 NYQFRRHLATKYTAKITSTSPTGRSLAAEVTPPTPLPSDVRGYSLPRRDLICKATQILLS 82 >XP_015959359.1 PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Arachis duranensis] Length = 667 Score = 108 bits (269), Expect = 7e-26 Identities = 53/61 (86%), Positives = 55/61 (90%) Frame = +1 Query: 16 RRHFATKYTAKITSTSPTGRSLAAEVTPPPPLPYDVRGYPLPRRDLICKATQILLSHSHS 195 RRHFATKYTAKITSTSPTGRSLAAEVTPP PLP D RGY LPRR LICKATQILLSH ++ Sbjct: 14 RRHFATKYTAKITSTSPTGRSLAAEVTPPRPLPSDPRGYLLPRRHLICKATQILLSHYNN 73 Query: 196 H 198 H Sbjct: 74 H 74 >KOM53147.1 hypothetical protein LR48_Vigan09g180600 [Vigna angularis] Length = 259 Score = 103 bits (258), Expect = 8e-26 Identities = 51/59 (86%), Positives = 53/59 (89%) Frame = +1 Query: 7 FRFRRHFATKYTAKITSTSPTGRSLAAEVTPPPPLPYDVRGYPLPRRDLICKATQILLS 183 F RR FATKYTA+ITST+PTGRSLAAEVTPPPPLP D RGY LPRRDLICKATQILLS Sbjct: 7 FHLRRCFATKYTARITSTAPTGRSLAAEVTPPPPLPSDPRGYLLPRRDLICKATQILLS 65 >XP_003594555.1 PPR containing plant-like protein [Medicago truncatula] AES64806.1 PPR containing plant-like protein [Medicago truncatula] Length = 639 Score = 105 bits (263), Expect = 4e-25 Identities = 52/60 (86%), Positives = 52/60 (86%) Frame = +1 Query: 4 HFRFRRHFATKYTAKITSTSPTGRSLAAEVTPPPPLPYDVRGYPLPRRDLICKATQILLS 183 H RRHFATKYTAKITSTSPTGRSLAAEVTPPPPLP D GY LPR DLICKATQILLS Sbjct: 5 HHHLRRHFATKYTAKITSTSPTGRSLAAEVTPPPPLPSDPLGYNLPRPDLICKATQILLS 64 >XP_008228402.1 PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Prunus mume] Length = 661 Score = 105 bits (261), Expect = 8e-25 Identities = 50/60 (83%), Positives = 54/60 (90%) Frame = +1 Query: 16 RRHFATKYTAKITSTSPTGRSLAAEVTPPPPLPYDVRGYPLPRRDLICKATQILLSHSHS 195 RRH+ATKYTAKITSTSPTG S++AEVTPPPPLP D+RGY LPRRDLICKATQILL S S Sbjct: 24 RRHYATKYTAKITSTSPTGLSVSAEVTPPPPLPTDIRGYALPRRDLICKATQILLRQSPS 83 >XP_007215014.1 hypothetical protein PRUPE_ppa002515mg [Prunus persica] ONI15708.1 hypothetical protein PRUPE_3G056800 [Prunus persica] Length = 663 Score = 105 bits (261), Expect = 8e-25 Identities = 50/60 (83%), Positives = 54/60 (90%) Frame = +1 Query: 16 RRHFATKYTAKITSTSPTGRSLAAEVTPPPPLPYDVRGYPLPRRDLICKATQILLSHSHS 195 RRH+ATKYTAKITSTSPTG S++AEVTPPPPLP D+RGY LPRRDLICKATQILL S S Sbjct: 26 RRHYATKYTAKITSTSPTGLSVSAEVTPPPPLPTDIRGYALPRRDLICKATQILLRQSPS 85 >XP_017433996.1 PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Vigna angularis] BAT87695.1 hypothetical protein VIGAN_05108900 [Vigna angularis var. angularis] Length = 646 Score = 103 bits (258), Expect = 2e-24 Identities = 51/59 (86%), Positives = 53/59 (89%) Frame = +1 Query: 7 FRFRRHFATKYTAKITSTSPTGRSLAAEVTPPPPLPYDVRGYPLPRRDLICKATQILLS 183 F RR FATKYTA+ITST+PTGRSLAAEVTPPPPLP D RGY LPRRDLICKATQILLS Sbjct: 7 FHLRRCFATKYTARITSTAPTGRSLAAEVTPPPPLPSDPRGYLLPRRDLICKATQILLS 65 >XP_014517084.1 PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Vigna radiata var. radiata] Length = 646 Score = 103 bits (258), Expect = 2e-24 Identities = 51/59 (86%), Positives = 53/59 (89%) Frame = +1 Query: 7 FRFRRHFATKYTAKITSTSPTGRSLAAEVTPPPPLPYDVRGYPLPRRDLICKATQILLS 183 F RR FATKYTA+ITST+PTGRSLAAEVTPPPPLP D RGY LPRRDLICKATQILLS Sbjct: 7 FHLRRCFATKYTARITSTAPTGRSLAAEVTPPPPLPSDPRGYLLPRRDLICKATQILLS 65 >XP_007147463.1 hypothetical protein PHAVU_006G126800g [Phaseolus vulgaris] ESW19457.1 hypothetical protein PHAVU_006G126800g [Phaseolus vulgaris] Length = 646 Score = 103 bits (257), Expect = 3e-24 Identities = 50/59 (84%), Positives = 53/59 (89%) Frame = +1 Query: 7 FRFRRHFATKYTAKITSTSPTGRSLAAEVTPPPPLPYDVRGYPLPRRDLICKATQILLS 183 F RR FATKYTA+ITS++PTGRSLAAEVTPPPPLP D RGY LPRRDLICKATQILLS Sbjct: 7 FHLRRRFATKYTARITSSAPTGRSLAAEVTPPPPLPSDPRGYLLPRRDLICKATQILLS 65 >XP_009344487.1 PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Pyrus x bretschneideri] Length = 660 Score = 100 bits (250), Expect = 2e-23 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = +1 Query: 19 RHFATKYTAKITSTSPTGRSLAAEVTPPPPLPYDVRGYPLPRRDLICKATQILL 180 RH+ATKYTAKITSTSPTG S++AEVTPPPPLP D+RGY LPRRDL+CKATQILL Sbjct: 23 RHYATKYTAKITSTSPTGLSVSAEVTPPPPLPTDIRGYALPRRDLVCKATQILL 76 >XP_008380840.1 PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Malus domestica] Length = 660 Score = 100 bits (250), Expect = 2e-23 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = +1 Query: 19 RHFATKYTAKITSTSPTGRSLAAEVTPPPPLPYDVRGYPLPRRDLICKATQILL 180 RH+ATKYTAKITSTSPTG S++AEVTPPPPLP D+RGY LPRRDL+CKATQILL Sbjct: 23 RHYATKYTAKITSTSPTGLSVSAEVTPPPPLPTDIRGYALPRRDLVCKATQILL 76 >XP_006597666.1 PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Glycine max] KRH11807.1 hypothetical protein GLYMA_15G131800 [Glycine max] Length = 648 Score = 100 bits (249), Expect = 3e-23 Identities = 50/56 (89%), Positives = 51/56 (91%) Frame = +1 Query: 16 RRHFATKYTAKITSTSPTGRSLAAEVTPPPPLPYDVRGYPLPRRDLICKATQILLS 183 RRHFATKYTAKITST+ TGRSLAAEVT PPPLP D RGY LPRRDLICKATQILLS Sbjct: 10 RRHFATKYTAKITSTTATGRSLAAEVTVPPPLPSDPRGYLLPRRDLICKATQILLS 65 >XP_004305254.1 PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Fragaria vesca subsp. vesca] XP_011466647.1 PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Fragaria vesca subsp. vesca] Length = 652 Score = 100 bits (249), Expect = 3e-23 Identities = 45/59 (76%), Positives = 52/59 (88%) Frame = +1 Query: 19 RHFATKYTAKITSTSPTGRSLAAEVTPPPPLPYDVRGYPLPRRDLICKATQILLSHSHS 195 RH+ATKYTAK+TSTSPTGR+L+ EVTPPPPLP D+RGY L RRDL+CKATQI+L S S Sbjct: 17 RHYATKYTAKVTSTSPTGRTLSVEVTPPPPLPTDIRGYTLTRRDLVCKATQIILHQSRS 75 >XP_015880442.1 PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial, partial [Ziziphus jujuba] Length = 533 Score = 99.4 bits (246), Expect = 7e-23 Identities = 48/60 (80%), Positives = 53/60 (88%) Frame = +1 Query: 16 RRHFATKYTAKITSTSPTGRSLAAEVTPPPPLPYDVRGYPLPRRDLICKATQILLSHSHS 195 +RH+ATKYTAKITSTSPTGRSL+AEVTPP P P D+RGY LPRRDLICKAT+ILL S S Sbjct: 28 QRHYATKYTAKITSTSPTGRSLSAEVTPPLPHPTDIRGYALPRRDLICKATRILLHQSPS 87 >GAV75922.1 LOW QUALITY PROTEIN: PPR domain-containing protein/Acid_phosphat_B domain-containing protein/PPR_1 domain-containing protein/PPR_2 domain-containing protein [Cephalotus follicularis] Length = 925 Score = 97.8 bits (242), Expect = 3e-22 Identities = 47/56 (83%), Positives = 50/56 (89%) Frame = +1 Query: 16 RRHFATKYTAKITSTSPTGRSLAAEVTPPPPLPYDVRGYPLPRRDLICKATQILLS 183 RRHFATKYTAKITSTSPTG S++AEV PPPLP D RGYP+PRR LICKATQILLS Sbjct: 48 RRHFATKYTAKITSTSPTGSSVSAEVDLPPPLPSDSRGYPIPRRHLICKATQILLS 103 >KDO51842.1 hypothetical protein CISIN_1g0413311mg, partial [Citrus sinensis] Length = 247 Score = 92.8 bits (229), Expect = 1e-21 Identities = 43/61 (70%), Positives = 49/61 (80%) Frame = +1 Query: 19 RHFATKYTAKITSTSPTGRSLAAEVTPPPPLPYDVRGYPLPRRDLICKATQILLSHSHSH 198 RH+ATKY AKITSTSPTGRS+ AEVTPP P+P D RGYP+PRR +ICKAT +LL S Sbjct: 18 RHYATKYIAKITSTSPTGRSVTAEVTPPQPIPSDTRGYPIPRRHVICKATNLLLESRPSG 77 Query: 199 S 201 S Sbjct: 78 S 78 >XP_006426850.1 hypothetical protein CICLE_v10025103mg [Citrus clementina] ESR40090.1 hypothetical protein CICLE_v10025103mg [Citrus clementina] Length = 656 Score = 94.7 bits (234), Expect = 4e-21 Identities = 44/62 (70%), Positives = 50/62 (80%) Frame = +1 Query: 16 RRHFATKYTAKITSTSPTGRSLAAEVTPPPPLPYDVRGYPLPRRDLICKATQILLSHSHS 195 RRH+ATKY AKITSTSPTGRS+ AEVTPP P+P D RGYP+PRR +ICKAT +LL S Sbjct: 17 RRHYATKYIAKITSTSPTGRSVTAEVTPPQPIPSDTRGYPIPRRHVICKATNLLLQSRPS 76 Query: 196 HS 201 S Sbjct: 77 GS 78 >XP_010062550.1 PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial [Eucalyptus grandis] KCW69689.1 hypothetical protein EUGRSUZ_F03084 [Eucalyptus grandis] Length = 669 Score = 94.7 bits (234), Expect = 4e-21 Identities = 43/55 (78%), Positives = 49/55 (89%) Frame = +1 Query: 16 RRHFATKYTAKITSTSPTGRSLAAEVTPPPPLPYDVRGYPLPRRDLICKATQILL 180 RR +ATKYTA++TS SP+GRSL+AEV PPPPLP DVRGYP+PRRDLIC AT ILL Sbjct: 23 RRRYATKYTARVTSISPSGRSLSAEVPPPPPLPTDVRGYPIPRRDLICAATNILL 77