BLASTX nr result
ID: Glycyrrhiza32_contig00019672
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00019672 (382 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU19249.1 hypothetical protein TSUD_199300 [Trifolium subterran... 95 5e-21 YP_007516911.1 hypothetical protein GlmaxMp62 (mitochondrion) [G... 90 7e-21 >GAU19249.1 hypothetical protein TSUD_199300 [Trifolium subterraneum] Length = 317 Score = 95.1 bits (235), Expect = 5e-21 Identities = 44/49 (89%), Positives = 45/49 (91%) Frame = +3 Query: 210 MILRPIVPQLGNLPATKLFVWPGASLWALGKQSHLVDIWELAKKQYQRG 356 MILRPIVPQLGNLPATKLFVWPGASLWALGKQSHLVDIWELAK + G Sbjct: 1 MILRPIVPQLGNLPATKLFVWPGASLWALGKQSHLVDIWELAKNSTKEG 49 >YP_007516911.1 hypothetical protein GlmaxMp62 (mitochondrion) [Glycine max] AFR34367.1 hypothetical protein GlmaxMp62 (mitochondrion) [Glycine max] Length = 105 Score = 89.7 bits (221), Expect = 7e-21 Identities = 43/49 (87%), Positives = 44/49 (89%) Frame = +3 Query: 210 MILRPIVPQLGNLPATKLFVWPGASLWALGKQSHLVDIWELAKKQYQRG 356 MILRPIVPQLGNLPATKLFVWPGASLWALGKQSHLVDI ELAK + G Sbjct: 1 MILRPIVPQLGNLPATKLFVWPGASLWALGKQSHLVDIRELAKNSTKEG 49