BLASTX nr result
ID: Glycyrrhiza32_contig00019513
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00019513 (261 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CBZ41764.1 drought responsive element binding protein 1 [Glycine... 55 6e-07 AAV66464.1 drought responsive element binding protein [Glycine s... 55 6e-07 NP_001235507.1 CBF-like protein [Glycine max] AAQ02703.1 CBF-lik... 55 6e-07 KRH38616.1 hypothetical protein GLYMA_09G147200 [Glycine max] 55 9e-07 KYP36472.1 Dehydration-responsive element-binding protein 1C [Ca... 54 1e-06 NP_001267504.1 uncharacterized protein LOC100819565 [Glycine max... 54 2e-06 >CBZ41764.1 drought responsive element binding protein 1 [Glycine max] Length = 234 Score = 54.7 bits (130), Expect = 6e-07 Identities = 31/54 (57%), Positives = 36/54 (66%) Frame = -1 Query: 255 AAAKERGVFDMXXXXXEVLDMPEMVRNMVLMSPTHSFGCEYAYGDYDVDLQDAE 94 A A +GVF M VLDMPE++RN+VLMSPTH G Y Y D D+D QDAE Sbjct: 176 ATATAQGVFYMEEEEQ-VLDMPELLRNVVLMSPTHCLG--YEYEDADLDAQDAE 226 >AAV66464.1 drought responsive element binding protein [Glycine soja] Length = 234 Score = 54.7 bits (130), Expect = 6e-07 Identities = 31/52 (59%), Positives = 35/52 (67%) Frame = -1 Query: 249 AKERGVFDMXXXXXEVLDMPEMVRNMVLMSPTHSFGCEYAYGDYDVDLQDAE 94 A +GVF M VLDMPE++RNMVLMSPTH G Y Y D D+D QDAE Sbjct: 178 ATAQGVFYMEEEEQ-VLDMPELLRNMVLMSPTHCLG--YEYEDADLDAQDAE 226 >NP_001235507.1 CBF-like protein [Glycine max] AAQ02703.1 CBF-like protein [Glycine max] ACA64423.1 CRT binding factor 1 [Glycine max] ACJ39208.1 CRT/DRE binding factor [Glycine max] ACR44232.1 drought responsive element binding protein 1 [Glycine max] CCF23018.1 drought responsive element binding protein 1 [Glycine max] CCF23019.1 drought responsive element binding protein 1 [Glycine max] Length = 234 Score = 54.7 bits (130), Expect = 6e-07 Identities = 31/52 (59%), Positives = 35/52 (67%) Frame = -1 Query: 249 AKERGVFDMXXXXXEVLDMPEMVRNMVLMSPTHSFGCEYAYGDYDVDLQDAE 94 A +GVF M VLDMPE++RNMVLMSPTH G Y Y D D+D QDAE Sbjct: 178 ATAQGVFYMEEEEQ-VLDMPELLRNMVLMSPTHCLG--YEYEDADLDAQDAE 226 >KRH38616.1 hypothetical protein GLYMA_09G147200 [Glycine max] Length = 327 Score = 54.7 bits (130), Expect = 9e-07 Identities = 31/52 (59%), Positives = 35/52 (67%) Frame = -1 Query: 249 AKERGVFDMXXXXXEVLDMPEMVRNMVLMSPTHSFGCEYAYGDYDVDLQDAE 94 A +GVF M VLDMPE++RNMVLMSPTH G Y Y D D+D QDAE Sbjct: 271 ATAQGVFYMEEEEQ-VLDMPELLRNMVLMSPTHCLG--YEYEDADLDAQDAE 319 >KYP36472.1 Dehydration-responsive element-binding protein 1C [Cajanus cajan] Length = 218 Score = 53.9 bits (128), Expect = 1e-06 Identities = 27/50 (54%), Positives = 35/50 (70%) Frame = -1 Query: 243 ERGVFDMXXXXXEVLDMPEMVRNMVLMSPTHSFGCEYAYGDYDVDLQDAE 94 ++G+F M + LDMPE++RNMVLMSPTH G Y Y D D++ QDAE Sbjct: 163 QQGMFYMDEEEGQELDMPELLRNMVLMSPTHCLG--YEYEDADLEAQDAE 210 >NP_001267504.1 uncharacterized protein LOC100819565 [Glycine max] AEC12483.1 C-repeat/dehydration-responsive element-binding factor CBF1-2 [Glycine max] KRH09144.1 hypothetical protein GLYMA_16G199000 [Glycine max] Length = 231 Score = 53.5 bits (127), Expect = 2e-06 Identities = 29/51 (56%), Positives = 36/51 (70%) Frame = -1 Query: 246 KERGVFDMXXXXXEVLDMPEMVRNMVLMSPTHSFGCEYAYGDYDVDLQDAE 94 ++RG+F +VLDMPE++RNMVLMSPTH G Y Y D D+D QDAE Sbjct: 176 QKRGMF-YTEEEEQVLDMPELLRNMVLMSPTHCIG--YEYEDADLDAQDAE 223