BLASTX nr result
ID: Glycyrrhiza32_contig00019480
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00019480 (771 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KOM53246.1 hypothetical protein LR48_Vigan09g190500 [Vigna angul... 55 5e-06 XP_018503964.1 PREDICTED: F-box/kelch-repeat protein At3g06240-l... 57 6e-06 XP_009788293.1 PREDICTED: F-box protein At3g08750-like [Nicotian... 55 7e-06 >KOM53246.1 hypothetical protein LR48_Vigan09g190500 [Vigna angularis] KOM56662.1 hypothetical protein LR48_Vigan10g255400 [Vigna angularis] Length = 138 Score = 55.1 bits (131), Expect = 5e-06 Identities = 25/48 (52%), Positives = 34/48 (70%) Frame = +3 Query: 252 AQFLPHYLVLRSLSRLPVKSLVRNKCVSRRWDSLIFDKDFIKLHHDRA 395 A LP L+ LS LP KSL+R +CVS W+SLI + DF++LHH+R+ Sbjct: 8 ATILPDTLISEILSWLPAKSLMRFRCVSNTWNSLIINPDFLELHHERS 55 >XP_018503964.1 PREDICTED: F-box/kelch-repeat protein At3g06240-like [Pyrus x bretschneideri] Length = 405 Score = 57.4 bits (137), Expect = 6e-06 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 1/59 (1%) Frame = +3 Query: 234 QYQ-EEGAQFLPHYLVLRSLSRLPVKSLVRNKCVSRRWDSLIFDKDFIKLHHDRAKRWN 407 +YQ E LP +++ LSRL VKSL R KCVS+ W SLI D DF+K+H ++A +N Sbjct: 9 EYQLTESPNVLPSDIIINILSRLAVKSLCRFKCVSKPWRSLISDHDFVKVHFNKALEYN 67 >XP_009788293.1 PREDICTED: F-box protein At3g08750-like [Nicotiana sylvestris] Length = 160 Score = 55.1 bits (131), Expect = 7e-06 Identities = 31/78 (39%), Positives = 44/78 (56%) Frame = +3 Query: 252 AQFLPHYLVLRSLSRLPVKSLVRNKCVSRRWDSLIFDKDFIKLHHDRAKRWNFSCVT*GR 431 ++FLP +++ L L VK L+R K V R W +LI FI +HHDRAKR N C Sbjct: 5 SKFLPGEIIMAILLALTVKPLLRFKSVCRSWHALILSLPFINMHHDRAKRNNLICFY--- 61 Query: 432 GRGKVHLFHFISFQE*KT 485 K H+++ +S E +T Sbjct: 62 ---KQHVYNSVSVCEDET 76