BLASTX nr result
ID: Glycyrrhiza32_contig00019233
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00019233 (270 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU48793.1 hypothetical protein TSUD_141110 [Trifolium subterran... 54 2e-06 >GAU48793.1 hypothetical protein TSUD_141110 [Trifolium subterraneum] Length = 236 Score = 53.5 bits (127), Expect = 2e-06 Identities = 30/53 (56%), Positives = 34/53 (64%) Frame = -2 Query: 176 PTLDLSFSITPKVRXXXXXXXXXXXLVVSIGYRNRKLGFLSSVSDGCIRAHDS 18 P LDLSFS+T KVR L VS+GYRNR+LGF+SSV G IRA S Sbjct: 101 PILDLSFSLTVKVRNRDFFSLTYDSLDVSVGYRNRQLGFISSVGGGRIRARGS 153