BLASTX nr result
ID: Glycyrrhiza32_contig00019160
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00019160 (202 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN18876.1 WD repeat-containing protein 5 [Glycine soja] 76 8e-16 XP_004495198.1 PREDICTED: COMPASS-like H3K4 histone methylase co... 79 9e-16 KHN03803.1 WD repeat-containing protein 5 [Glycine soja] 76 1e-15 XP_003590636.1 transducin/WD40 repeat protein [Medicago truncatu... 76 6e-15 XP_006444050.1 hypothetical protein CICLE_v10021263mg [Citrus cl... 76 8e-15 XP_003536561.1 PREDICTED: COMPASS-like H3K4 histone methylase co... 76 8e-15 XP_003518920.1 PREDICTED: COMPASS-like H3K4 histone methylase co... 76 8e-15 XP_018856064.1 PREDICTED: COMPASS-like H3K4 histone methylase co... 75 1e-14 CBI28701.3 unnamed protein product, partial [Vitis vinifera] 72 2e-14 XP_019452681.1 PREDICTED: COMPASS-like H3K4 histone methylase co... 75 2e-14 JAT50877.1 WD repeat-containing protein 5, partial [Anthurium am... 74 4e-14 XP_012473538.1 PREDICTED: COMPASS-like H3K4 histone methylase co... 74 4e-14 GAU37189.1 hypothetical protein TSUD_30540 [Trifolium subterraneum] 74 6e-14 XP_015575611.1 PREDICTED: COMPASS-like H3K4 histone methylase co... 74 6e-14 XP_002520730.1 PREDICTED: COMPASS-like H3K4 histone methylase co... 74 6e-14 XP_016182940.1 PREDICTED: COMPASS-like H3K4 histone methylase co... 74 6e-14 XP_015948400.1 PREDICTED: COMPASS-like H3K4 histone methylase co... 74 6e-14 XP_008653267.1 PREDICTED: WD repeat-containing protein 5-like [Z... 70 7e-14 KYP43334.1 WD repeat-containing protein 5 [Cajanus cajan] 70 1e-13 XP_010277470.1 PREDICTED: COMPASS-like H3K4 histone methylase co... 73 1e-13 >KHN18876.1 WD repeat-containing protein 5 [Glycine soja] Length = 163 Score = 75.9 bits (185), Expect = 8e-16 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 200 GHTDTVISVTCHPTENKIASAGLDGDRTVRVWVQDS 93 GHTDTVISVTCHPTENKIASAGL GDRTVRVWVQDS Sbjct: 128 GHTDTVISVTCHPTENKIASAGLAGDRTVRVWVQDS 163 >XP_004495198.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Cicer arietinum] Length = 326 Score = 78.6 bits (192), Expect = 9e-16 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 200 GHTDTVISVTCHPTENKIASAGLDGDRTVRVWVQDS 93 GHTDTVISVTCHPTENKIASAGLDGDRTVR+WVQDS Sbjct: 291 GHTDTVISVTCHPTENKIASAGLDGDRTVRIWVQDS 326 >KHN03803.1 WD repeat-containing protein 5 [Glycine soja] Length = 172 Score = 75.9 bits (185), Expect = 1e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 200 GHTDTVISVTCHPTENKIASAGLDGDRTVRVWVQDS 93 GHTDTVISVTCHPTENKIASAGL GDRTVRVWVQDS Sbjct: 137 GHTDTVISVTCHPTENKIASAGLAGDRTVRVWVQDS 172 >XP_003590636.1 transducin/WD40 repeat protein [Medicago truncatula] AES60887.1 transducin/WD40 repeat protein [Medicago truncatula] AFK38716.1 unknown [Medicago truncatula] Length = 316 Score = 76.3 bits (186), Expect = 6e-15 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 200 GHTDTVISVTCHPTENKIASAGLDGDRTVRVWVQDS 93 GHTDTVISVTCHP ENKIASAGLDGDRTVR+WVQDS Sbjct: 281 GHTDTVISVTCHPKENKIASAGLDGDRTVRIWVQDS 316 >XP_006444050.1 hypothetical protein CICLE_v10021263mg [Citrus clementina] XP_006479705.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Citrus sinensis] ESR57290.1 hypothetical protein CICLE_v10021263mg [Citrus clementina] KDO68705.1 hypothetical protein CISIN_1g021459mg [Citrus sinensis] Length = 312 Score = 75.9 bits (185), Expect = 8e-15 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 200 GHTDTVISVTCHPTENKIASAGLDGDRTVRVWVQD 96 GHTD+VISVTCHPTENKIASAGLDGDRTVRVWVQD Sbjct: 277 GHTDSVISVTCHPTENKIASAGLDGDRTVRVWVQD 311 >XP_003536561.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Glycine max] KRH32024.1 hypothetical protein GLYMA_10G027100 [Glycine max] Length = 319 Score = 75.9 bits (185), Expect = 8e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 200 GHTDTVISVTCHPTENKIASAGLDGDRTVRVWVQDS 93 GHTDTVISVTCHPTENKIASAGL GDRTVRVWVQDS Sbjct: 284 GHTDTVISVTCHPTENKIASAGLAGDRTVRVWVQDS 319 >XP_003518920.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Glycine max] KRH71413.1 hypothetical protein GLYMA_02G146800 [Glycine max] Length = 320 Score = 75.9 bits (185), Expect = 8e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 200 GHTDTVISVTCHPTENKIASAGLDGDRTVRVWVQDS 93 GHTDTVISVTCHPTENKIASAGL GDRTVRVWVQDS Sbjct: 285 GHTDTVISVTCHPTENKIASAGLAGDRTVRVWVQDS 320 >XP_018856064.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Juglans regia] Length = 313 Score = 75.5 bits (184), Expect = 1e-14 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 200 GHTDTVISVTCHPTENKIASAGLDGDRTVRVWVQDS 93 GH+DTVISVTCHPTENKIASAGLDGDRTVR+W QDS Sbjct: 278 GHSDTVISVTCHPTENKIASAGLDGDRTVRIWAQDS 313 >CBI28701.3 unnamed protein product, partial [Vitis vinifera] Length = 163 Score = 72.4 bits (176), Expect = 2e-14 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -3 Query: 200 GHTDTVISVTCHPTENKIASAGLDGDRTVRVWVQD 96 GHTDTVISV+CHP ENKIASAGLDGD+TVR+WVQD Sbjct: 128 GHTDTVISVSCHPNENKIASAGLDGDKTVRIWVQD 162 >XP_019452681.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Lupinus angustifolius] XP_019452682.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Lupinus angustifolius] OIW06741.1 hypothetical protein TanjilG_11466 [Lupinus angustifolius] Length = 320 Score = 74.7 bits (182), Expect = 2e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 200 GHTDTVISVTCHPTENKIASAGLDGDRTVRVWVQD 96 GHTDTVISVTCHPTENKIASAGLD DRTVR+WVQD Sbjct: 285 GHTDTVISVTCHPTENKIASAGLDNDRTVRIWVQD 319 >JAT50877.1 WD repeat-containing protein 5, partial [Anthurium amnicola] Length = 316 Score = 73.9 bits (180), Expect = 4e-14 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -3 Query: 200 GHTDTVISVTCHPTENKIASAGLDGDRTVRVWVQDS 93 GHTDTV+SV+CHPTENKIASAGLD DRT+R+WVQDS Sbjct: 280 GHTDTVVSVSCHPTENKIASAGLDNDRTIRIWVQDS 315 >XP_012473538.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Gossypium raimondii] KJB22590.1 hypothetical protein B456_004G055700 [Gossypium raimondii] Length = 317 Score = 73.9 bits (180), Expect = 4e-14 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -3 Query: 200 GHTDTVISVTCHPTENKIASAGLDGDRTVRVWVQDS 93 GH+DTVISVTCHP ENKIASAGLDGDRT+RVWVQD+ Sbjct: 282 GHSDTVISVTCHPVENKIASAGLDGDRTIRVWVQDA 317 >GAU37189.1 hypothetical protein TSUD_30540 [Trifolium subterraneum] Length = 316 Score = 73.6 bits (179), Expect = 6e-14 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -3 Query: 200 GHTDTVISVTCHPTENKIASAGLDGDRTVRVWVQDS 93 GHTDTVISVTCHPTENKIASAGLD D+TVR+WVQ+S Sbjct: 281 GHTDTVISVTCHPTENKIASAGLDADKTVRIWVQES 316 >XP_015575611.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B isoform X2 [Ricinus communis] Length = 317 Score = 73.6 bits (179), Expect = 6e-14 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -3 Query: 200 GHTDTVISVTCHPTENKIASAGLDGDRTVRVWVQDS 93 GH+DTVISVTCHPTENKIASAGLD DRT++VWVQDS Sbjct: 282 GHSDTVISVTCHPTENKIASAGLDADRTIKVWVQDS 317 >XP_002520730.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B isoform X1 [Ricinus communis] EEF41692.1 WD-repeat protein, putative [Ricinus communis] Length = 318 Score = 73.6 bits (179), Expect = 6e-14 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -3 Query: 200 GHTDTVISVTCHPTENKIASAGLDGDRTVRVWVQDS 93 GH+DTVISVTCHPTENKIASAGLD DRT++VWVQDS Sbjct: 283 GHSDTVISVTCHPTENKIASAGLDADRTIKVWVQDS 318 >XP_016182940.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Arachis ipaensis] XP_016182941.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Arachis ipaensis] XP_016182942.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Arachis ipaensis] XP_016182943.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Arachis ipaensis] Length = 319 Score = 73.6 bits (179), Expect = 6e-14 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -3 Query: 200 GHTDTVISVTCHPTENKIASAGLDGDRTVRVWVQDS 93 GHTDTVISV+CHPTENKIASAGLD DRTVR+WVQD+ Sbjct: 284 GHTDTVISVSCHPTENKIASAGLDNDRTVRIWVQDA 319 >XP_015948400.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Arachis duranensis] XP_015948401.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Arachis duranensis] XP_015948402.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Arachis duranensis] XP_015948403.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Arachis duranensis] Length = 319 Score = 73.6 bits (179), Expect = 6e-14 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -3 Query: 200 GHTDTVISVTCHPTENKIASAGLDGDRTVRVWVQDS 93 GHTDTVISV+CHPTENKIASAGLD DRTVR+WVQD+ Sbjct: 284 GHTDTVISVSCHPTENKIASAGLDNDRTVRIWVQDA 319 >XP_008653267.1 PREDICTED: WD repeat-containing protein 5-like [Zea mays] Length = 114 Score = 69.7 bits (169), Expect = 7e-14 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -3 Query: 200 GHTDTVISVTCHPTENKIASAGLDGDRTVRVWVQDS 93 GHTDTVISV+CHPTENKIAS GL DRTVR+WVQDS Sbjct: 79 GHTDTVISVSCHPTENKIASGGLHNDRTVRLWVQDS 114 >KYP43334.1 WD repeat-containing protein 5 [Cajanus cajan] Length = 163 Score = 70.5 bits (171), Expect = 1e-13 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -3 Query: 200 GHTDTVISVTCHPTENKIASAGLDGDRTVRVWVQDS 93 GHTDTVISVT HP ENKIASAGL GDRTVRVWVQDS Sbjct: 128 GHTDTVISVTSHPKENKIASAGLQGDRTVRVWVQDS 163 >XP_010277470.1 PREDICTED: COMPASS-like H3K4 histone methylase component WDR5B [Nelumbo nucifera] Length = 317 Score = 72.8 bits (177), Expect = 1e-13 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -3 Query: 200 GHTDTVISVTCHPTENKIASAGLDGDRTVRVWVQDS 93 GHTDTVISVTCHPTENKIASAGLD DRT+++WVQD+ Sbjct: 282 GHTDTVISVTCHPTENKIASAGLDKDRTIKIWVQDT 317