BLASTX nr result
ID: Glycyrrhiza32_contig00018827
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00018827 (792 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016187632.1 PREDICTED: rhodanese-like domain-containing prote... 59 1e-06 XP_015954529.1 PREDICTED: rhodanese-like domain-containing prote... 59 1e-06 >XP_016187632.1 PREDICTED: rhodanese-like domain-containing protein 11, chloroplastic [Arachis ipaensis] Length = 292 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 595 IMDGKIEVLTPRKAGCAVQLSNNPFYDVLPSNEHN 491 I DGK++VLTPR+AG AVQLSN PF DV PSNEHN Sbjct: 83 IRDGKVKVLTPREAGYAVQLSNKPFLDVRPSNEHN 117 >XP_015954529.1 PREDICTED: rhodanese-like domain-containing protein 11, chloroplastic [Arachis duranensis] Length = 292 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 595 IMDGKIEVLTPRKAGCAVQLSNNPFYDVLPSNEHN 491 I DGK++VLTPR+AG AVQLSN PF DV PSNEHN Sbjct: 83 IRDGKVKVLTPREAGYAVQLSNKPFLDVRPSNEHN 117