BLASTX nr result
ID: Glycyrrhiza32_contig00018819
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00018819 (211 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN19718.1 Putative receptor-like protein kinase [Glycine soja] 60 5e-09 XP_003521049.1 PREDICTED: probable receptor-like protein kinase ... 60 5e-09 KHN01616.1 Putative receptor-like protein kinase [Glycine soja] 60 6e-09 XP_003530124.1 PREDICTED: probable receptor-like protein kinase ... 60 6e-09 KYP42498.1 putative serine/threonine-protein kinase NAK [Cajanus... 60 6e-09 XP_010089771.1 putative receptor-like protein kinase [Morus nota... 58 3e-08 XP_009376148.1 PREDICTED: probable receptor-like protein kinase ... 58 3e-08 XP_009376146.1 PREDICTED: probable receptor-like protein kinase ... 58 3e-08 XP_009370940.1 PREDICTED: probable receptor-like protein kinase ... 58 3e-08 XP_009370938.1 PREDICTED: probable receptor-like protein kinase ... 58 3e-08 XP_004133967.1 PREDICTED: probable receptor-like protein kinase ... 58 4e-08 XP_007134382.1 hypothetical protein PHAVU_010G043100g [Phaseolus... 58 4e-08 XP_008382233.1 PREDICTED: probable receptor-like protein kinase ... 57 6e-08 XP_004516992.1 PREDICTED: probable receptor-like protein kinase ... 57 6e-08 XP_008343874.1 PREDICTED: probable receptor-like protein kinase ... 57 8e-08 XP_017440793.1 PREDICTED: probable receptor-like protein kinase ... 55 4e-07 XP_015897848.1 PREDICTED: probable receptor-like protein kinase ... 55 5e-07 XP_008232338.1 PREDICTED: probable receptor-like protein kinase ... 54 7e-07 XP_007218043.1 hypothetical protein PRUPE_ppa006098mg [Prunus pe... 54 7e-07 XP_014515036.1 PREDICTED: probable receptor-like protein kinase ... 54 9e-07 >KHN19718.1 Putative receptor-like protein kinase [Glycine soja] Length = 430 Score = 60.5 bits (145), Expect = 5e-09 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 97 MKCFYYFKDKARSRRQRSAPELKEQEKLQLSG 2 MKCFYYF+DK+RS +QRSAPELK+QEKL+LSG Sbjct: 1 MKCFYYFRDKSRSSKQRSAPELKDQEKLELSG 32 >XP_003521049.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Glycine max] XP_006576694.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Glycine max] XP_006576695.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Glycine max] XP_006576696.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Glycine max] XP_006576697.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Glycine max] KRH66419.1 hypothetical protein GLYMA_03G105500 [Glycine max] KRH66420.1 hypothetical protein GLYMA_03G105500 [Glycine max] KRH66421.1 hypothetical protein GLYMA_03G105500 [Glycine max] KRH66422.1 hypothetical protein GLYMA_03G105500 [Glycine max] KRH66423.1 hypothetical protein GLYMA_03G105500 [Glycine max] Length = 430 Score = 60.5 bits (145), Expect = 5e-09 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 97 MKCFYYFKDKARSRRQRSAPELKEQEKLQLSG 2 MKCFYYF+DK+RS +QRSAPELK+QEKL+LSG Sbjct: 1 MKCFYYFRDKSRSSKQRSAPELKDQEKLELSG 32 >KHN01616.1 Putative receptor-like protein kinase [Glycine soja] Length = 430 Score = 60.1 bits (144), Expect = 6e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 97 MKCFYYFKDKARSRRQRSAPELKEQEKLQLSG 2 MKCFYYF+DK+RS +QRSAPELKEQEKL+ SG Sbjct: 1 MKCFYYFRDKSRSSKQRSAPELKEQEKLEFSG 32 >XP_003530124.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Glycine max] XP_006583519.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Glycine max] XP_014633427.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Glycine max] KRH48856.1 hypothetical protein GLYMA_07G117400 [Glycine max] KRH48857.1 hypothetical protein GLYMA_07G117400 [Glycine max] Length = 430 Score = 60.1 bits (144), Expect = 6e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 97 MKCFYYFKDKARSRRQRSAPELKEQEKLQLSG 2 MKCFYYF+DK+RS +QRSAPELKEQEKL+ SG Sbjct: 1 MKCFYYFRDKSRSSKQRSAPELKEQEKLEFSG 32 >KYP42498.1 putative serine/threonine-protein kinase NAK [Cajanus cajan] Length = 470 Score = 60.1 bits (144), Expect = 6e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 97 MKCFYYFKDKARSRRQRSAPELKEQEKLQLSG 2 MKCFYYFKDK R+++QRSAPELKEQEKL+ SG Sbjct: 1 MKCFYYFKDKYRNKKQRSAPELKEQEKLEFSG 32 >XP_010089771.1 putative receptor-like protein kinase [Morus notabilis] EXB38363.1 putative receptor-like protein kinase [Morus notabilis] Length = 428 Score = 58.2 bits (139), Expect = 3e-08 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 97 MKCFYYFKDKARSRRQRSAPELKEQEKLQLSG 2 MKCFYYFKDK +SR+QRSAPELKEQ K Q SG Sbjct: 1 MKCFYYFKDKTKSRQQRSAPELKEQSKSQYSG 32 >XP_009376148.1 PREDICTED: probable receptor-like protein kinase At5g47070 isoform X2 [Pyrus x bretschneideri] Length = 429 Score = 58.2 bits (139), Expect = 3e-08 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = -1 Query: 97 MKCFYYFKDKARSRRQRSAPELKEQEKLQLSG 2 MKCFYYFKDKARSR QRSAPELKEQ K SG Sbjct: 1 MKCFYYFKDKARSREQRSAPELKEQTKSDYSG 32 >XP_009376146.1 PREDICTED: probable receptor-like protein kinase At5g47070 isoform X1 [Pyrus x bretschneideri] XP_009376147.1 PREDICTED: probable receptor-like protein kinase At5g47070 isoform X1 [Pyrus x bretschneideri] Length = 429 Score = 58.2 bits (139), Expect = 3e-08 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = -1 Query: 97 MKCFYYFKDKARSRRQRSAPELKEQEKLQLSG 2 MKCFYYFKDKARSR QRSAPELKEQ K SG Sbjct: 1 MKCFYYFKDKARSREQRSAPELKEQTKSDYSG 32 >XP_009370940.1 PREDICTED: probable receptor-like protein kinase At5g47070 isoform X2 [Pyrus x bretschneideri] Length = 429 Score = 58.2 bits (139), Expect = 3e-08 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = -1 Query: 97 MKCFYYFKDKARSRRQRSAPELKEQEKLQLSG 2 MKCFYYFKDKARSR QRSAPELKEQ K SG Sbjct: 1 MKCFYYFKDKARSREQRSAPELKEQTKSDYSG 32 >XP_009370938.1 PREDICTED: probable receptor-like protein kinase At5g47070 isoform X1 [Pyrus x bretschneideri] XP_009370939.1 PREDICTED: probable receptor-like protein kinase At5g47070 isoform X1 [Pyrus x bretschneideri] Length = 429 Score = 58.2 bits (139), Expect = 3e-08 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = -1 Query: 97 MKCFYYFKDKARSRRQRSAPELKEQEKLQLSG 2 MKCFYYFKDKARSR QRSAPELKEQ K SG Sbjct: 1 MKCFYYFKDKARSREQRSAPELKEQTKSDYSG 32 >XP_004133967.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Cucumis sativus] KGN56688.1 hypothetical protein Csa_3G128960 [Cucumis sativus] Length = 426 Score = 57.8 bits (138), Expect = 4e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 97 MKCFYYFKDKARSRRQRSAPELKEQEKLQLSG 2 MKCFYYFKDK+RSRRQRSAP+LKEQ++ SG Sbjct: 1 MKCFYYFKDKSRSRRQRSAPQLKEQQESDFSG 32 >XP_007134382.1 hypothetical protein PHAVU_010G043100g [Phaseolus vulgaris] ESW06376.1 hypothetical protein PHAVU_010G043100g [Phaseolus vulgaris] Length = 429 Score = 57.8 bits (138), Expect = 4e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 97 MKCFYYFKDKARSRRQRSAPELKEQEKLQLSG 2 MKCFYYFKDK+R+ +QRSAPELK+QEKL SG Sbjct: 1 MKCFYYFKDKSRNSKQRSAPELKKQEKLDFSG 32 >XP_008382233.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Malus domestica] XP_008382234.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Malus domestica] XP_017190755.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Malus domestica] Length = 429 Score = 57.4 bits (137), Expect = 6e-08 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 97 MKCFYYFKDKARSRRQRSAPELKEQEKLQLSG 2 MKCFYYFKDKARSR QRSAPELKEQ + SG Sbjct: 1 MKCFYYFKDKARSREQRSAPELKEQRNSEYSG 32 >XP_004516992.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Cicer arietinum] Length = 436 Score = 57.4 bits (137), Expect = 6e-08 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -1 Query: 106 MRAMKCFYYFKDKARSRRQRSAPELKEQEKLQLSG 2 M MKCFYYFK K ++R QRSAPELKEQEKLQ SG Sbjct: 1 MTEMKCFYYFKYKFKNRGQRSAPELKEQEKLQFSG 35 >XP_008343874.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Malus domestica] XP_008343882.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Malus domestica] XP_008343889.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Malus domestica] XP_017180843.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Malus domestica] XP_017180847.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Malus domestica] Length = 429 Score = 57.0 bits (136), Expect = 8e-08 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 97 MKCFYYFKDKARSRRQRSAPELKEQEKLQLSG 2 MKCFYYFKDKARSR QRSAPELKE+ K SG Sbjct: 1 MKCFYYFKDKARSREQRSAPELKEETKSDYSG 32 >XP_017440793.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Vigna angularis] XP_017440795.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Vigna angularis] XP_017440796.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Vigna angularis] XP_017440797.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Vigna angularis] KOM58573.1 hypothetical protein LR48_Vigan11g160700 [Vigna angularis] BAT96875.1 hypothetical protein VIGAN_09018500 [Vigna angularis var. angularis] Length = 426 Score = 55.1 bits (131), Expect = 4e-07 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -1 Query: 97 MKCFYYFKDKARSRRQRSAPELKEQEKLQLSG 2 MKCF+YF+DK+R+ RQRSAPELKE+EK+ SG Sbjct: 1 MKCFHYFRDKSRNSRQRSAPELKEKEKMDFSG 32 >XP_015897848.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Ziziphus jujuba] Length = 492 Score = 54.7 bits (130), Expect = 5e-07 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -1 Query: 106 MRAMKCFYYFKDKARSRRQRSAPELKEQEKLQLS 5 + AMKCFYYFKD+ RSR QRSAPELKE++K S Sbjct: 61 LNAMKCFYYFKDRGRSREQRSAPELKERKKSDCS 94 >XP_008232338.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Prunus mume] XP_008232339.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Prunus mume] XP_008232340.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Prunus mume] XP_008232341.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Prunus mume] Length = 427 Score = 54.3 bits (129), Expect = 7e-07 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -1 Query: 97 MKCFYYFKDKARSRRQRSAPELKEQEKLQLSG 2 MKCFYYFK+K RSR Q+SAPELKEQ K SG Sbjct: 1 MKCFYYFKEKTRSREQKSAPELKEQRKSDYSG 32 >XP_007218043.1 hypothetical protein PRUPE_ppa006098mg [Prunus persica] ONI22278.1 hypothetical protein PRUPE_2G118500 [Prunus persica] ONI22279.1 hypothetical protein PRUPE_2G118500 [Prunus persica] ONI22280.1 hypothetical protein PRUPE_2G118500 [Prunus persica] ONI22281.1 hypothetical protein PRUPE_2G118500 [Prunus persica] ONI22282.1 hypothetical protein PRUPE_2G118500 [Prunus persica] Length = 427 Score = 54.3 bits (129), Expect = 7e-07 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = -1 Query: 97 MKCFYYFKDKARSRRQRSAPELKEQEKLQLSG 2 MKCFYYFKDK R R Q+SAPELKEQ K SG Sbjct: 1 MKCFYYFKDKTRGREQKSAPELKEQRKSDYSG 32 >XP_014515036.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Vigna radiata var. radiata] XP_014515037.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Vigna radiata var. radiata] XP_014515038.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Vigna radiata var. radiata] XP_014515039.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Vigna radiata var. radiata] XP_014515040.1 PREDICTED: probable receptor-like protein kinase At5g47070 [Vigna radiata var. radiata] Length = 426 Score = 53.9 bits (128), Expect = 9e-07 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -1 Query: 97 MKCFYYFKDKARSRRQRSAPELKEQEKLQLSG 2 MKCF+YF+DK+R+ RQRSAPELKE+E+L SG Sbjct: 1 MKCFHYFRDKSRNGRQRSAPELKEKEQLDFSG 32