BLASTX nr result
ID: Glycyrrhiza32_contig00017892
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00017892 (201 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDY44229.1 BnaC03g24210D [Brassica napus] 76 1e-16 CDY17926.1 BnaC04g02930D [Brassica napus] 77 2e-16 XP_006292105.1 hypothetical protein CARUB_v10018301mg, partial [... 76 2e-16 CDP04642.1 unnamed protein product [Coffea canephora] 76 2e-16 CDX89028.1 BnaA04g01580D [Brassica napus] 75 3e-16 XP_009138904.1 PREDICTED: 60S ribosomal protein L38-like [Brassi... 75 4e-16 XP_017430435.1 PREDICTED: 60S ribosomal protein L38-like [Vigna ... 75 5e-16 XP_007159382.1 hypothetical protein PHAVU_002G233500g, partial [... 75 9e-16 CDX98380.1 BnaC06g17410D [Brassica napus] 74 1e-15 KOM53597.1 hypothetical protein LR48_Vigan09g225600 [Vigna angul... 74 1e-15 JAU80427.1 60S ribosomal protein L38, partial [Noccaea caerulesc... 74 1e-15 JAU16410.1 60S ribosomal protein L38, partial [Noccaea caerulesc... 74 1e-15 XP_004485978.1 PREDICTED: 60S ribosomal protein L38-like [Cicer ... 74 1e-15 XP_018833003.1 PREDICTED: 60S ribosomal protein L38 [Juglans regia] 73 1e-15 XP_015962771.1 PREDICTED: 60S ribosomal protein L38-like [Arachi... 73 1e-15 XP_015875766.1 PREDICTED: 60S ribosomal protein L38 [Ziziphus ju... 73 1e-15 XP_014517950.1 PREDICTED: 60S ribosomal protein L38-like [Vigna ... 73 1e-15 XP_014508022.1 PREDICTED: 60S ribosomal protein L38-like [Vigna ... 73 1e-15 XP_006428680.1 hypothetical protein CICLE_v10013279mg [Citrus cl... 73 1e-15 AFK35386.1 unknown [Lotus japonicus] 73 1e-15 >CDY44229.1 BnaC03g24210D [Brassica napus] Length = 86 Score = 75.9 bits (185), Expect = 1e-16 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +1 Query: 88 PTMPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 201 PTMPKQIHEIKDFLLTARRKDARSVKIKRS+D+VKFKV Sbjct: 16 PTMPKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKV 53 >CDY17926.1 BnaC04g02930D [Brassica napus] Length = 135 Score = 77.0 bits (188), Expect = 2e-16 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +1 Query: 79 AVKPTMPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 201 A PTMPKQIHEIKDFLLTARRKDARSVKIKRS+D+VKFKV Sbjct: 9 ATDPTMPKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKV 49 >XP_006292105.1 hypothetical protein CARUB_v10018301mg, partial [Capsella rubella] EOA25003.1 hypothetical protein CARUB_v10018301mg, partial [Capsella rubella] Length = 100 Score = 75.9 bits (185), Expect = 2e-16 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +1 Query: 88 PTMPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 201 PTMPKQIHEIKDFLLTARRKDARSVKIKRS+D+VKFKV Sbjct: 30 PTMPKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKV 67 >CDP04642.1 unnamed protein product [Coffea canephora] Length = 104 Score = 75.9 bits (185), Expect = 2e-16 Identities = 39/47 (82%), Positives = 41/47 (87%) Frame = +1 Query: 61 ALAEEIAVKPTMPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 201 AL A+ P MPKQIHEIKDFLLTARRKDARSVKIKRS+DVVKFKV Sbjct: 25 ALHRGEALAPKMPKQIHEIKDFLLTARRKDARSVKIKRSKDVVKFKV 71 >CDX89028.1 BnaA04g01580D [Brassica napus] Length = 110 Score = 75.5 bits (184), Expect = 3e-16 Identities = 37/45 (82%), Positives = 40/45 (88%) Frame = +1 Query: 67 AEEIAVKPTMPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 201 A E +P MPKQIHEIKDFLLTARRKDARSVKIKRS+D+VKFKV Sbjct: 38 ASEQTSEPRMPKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKV 82 >XP_009138904.1 PREDICTED: 60S ribosomal protein L38-like [Brassica rapa] Length = 115 Score = 75.5 bits (184), Expect = 4e-16 Identities = 37/45 (82%), Positives = 40/45 (88%) Frame = +1 Query: 67 AEEIAVKPTMPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 201 A E +P MPKQIHEIKDFLLTARRKDARSVKIKRS+D+VKFKV Sbjct: 38 ASEQTSEPRMPKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKV 82 >XP_017430435.1 PREDICTED: 60S ribosomal protein L38-like [Vigna angularis] BAT74311.1 hypothetical protein VIGAN_01195500 [Vigna angularis var. angularis] Length = 99 Score = 74.7 bits (182), Expect = 5e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 91 TMPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 201 TMPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV Sbjct: 30 TMPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 66 >XP_007159382.1 hypothetical protein PHAVU_002G233500g, partial [Phaseolus vulgaris] ESW31376.1 hypothetical protein PHAVU_002G233500g, partial [Phaseolus vulgaris] Length = 122 Score = 74.7 bits (182), Expect = 9e-16 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 91 TMPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 201 TMPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV Sbjct: 53 TMPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 89 >CDX98380.1 BnaC06g17410D [Brassica napus] Length = 104 Score = 73.9 bits (180), Expect = 1e-15 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = +1 Query: 85 KPTMPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 201 +P MPKQIHEIKDFLLTARRKDARSVKIKRS+D+VKFKV Sbjct: 33 EPRMPKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKV 71 >KOM53597.1 hypothetical protein LR48_Vigan09g225600 [Vigna angularis] Length = 107 Score = 73.9 bits (180), Expect = 1e-15 Identities = 37/40 (92%), Positives = 37/40 (92%) Frame = +1 Query: 82 VKPTMPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 201 V P PKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV Sbjct: 41 VLPMQPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 80 >JAU80427.1 60S ribosomal protein L38, partial [Noccaea caerulescens] Length = 94 Score = 73.6 bits (179), Expect = 1e-15 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +1 Query: 88 PTMPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 201 PTMPKQIHEIKDFLLTARRKDARSVKIKRS+D VKFKV Sbjct: 24 PTMPKQIHEIKDFLLTARRKDARSVKIKRSKDNVKFKV 61 >JAU16410.1 60S ribosomal protein L38, partial [Noccaea caerulescens] Length = 94 Score = 73.6 bits (179), Expect = 1e-15 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +1 Query: 88 PTMPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 201 P MPKQIHEIKDFLLTARRKDARSVKIKRS+D+VKFKV Sbjct: 24 PRMPKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKV 61 >XP_004485978.1 PREDICTED: 60S ribosomal protein L38-like [Cicer arietinum] Length = 96 Score = 73.6 bits (179), Expect = 1e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +1 Query: 91 TMPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 201 TMPKQIHEIKDFLLTARRKDARSVKIKRS+DVVKFKV Sbjct: 27 TMPKQIHEIKDFLLTARRKDARSVKIKRSKDVVKFKV 63 >XP_018833003.1 PREDICTED: 60S ribosomal protein L38 [Juglans regia] Length = 69 Score = 72.8 bits (177), Expect = 1e-15 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 94 MPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 201 MPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV Sbjct: 1 MPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 36 >XP_015962771.1 PREDICTED: 60S ribosomal protein L38-like [Arachis duranensis] XP_016194274.1 PREDICTED: 60S ribosomal protein L38-like [Arachis ipaensis] Length = 69 Score = 72.8 bits (177), Expect = 1e-15 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 94 MPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 201 MPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV Sbjct: 1 MPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 36 >XP_015875766.1 PREDICTED: 60S ribosomal protein L38 [Ziziphus jujuba] Length = 69 Score = 72.8 bits (177), Expect = 1e-15 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 94 MPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 201 MPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV Sbjct: 1 MPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 36 >XP_014517950.1 PREDICTED: 60S ribosomal protein L38-like [Vigna radiata var. radiata] Length = 69 Score = 72.8 bits (177), Expect = 1e-15 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 94 MPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 201 MPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV Sbjct: 1 MPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 36 >XP_014508022.1 PREDICTED: 60S ribosomal protein L38-like [Vigna radiata var. radiata] Length = 69 Score = 72.8 bits (177), Expect = 1e-15 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 94 MPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 201 MPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV Sbjct: 1 MPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 36 >XP_006428680.1 hypothetical protein CICLE_v10013279mg [Citrus clementina] XP_006442966.1 hypothetical protein CICLE_v10023214mg [Citrus clementina] XP_006442967.1 hypothetical protein CICLE_v10023214mg [Citrus clementina] XP_006478751.1 PREDICTED: 60S ribosomal protein L38 [Citrus sinensis] XP_006480494.1 PREDICTED: 60S ribosomal protein L38 [Citrus sinensis] XP_011649040.1 PREDICTED: 60S ribosomal protein L38-like [Cucumis sativus] XP_015935557.1 PREDICTED: 60S ribosomal protein L38 [Arachis duranensis] XP_016169189.1 PREDICTED: 60S ribosomal protein L38 [Arachis ipaensis] ESR41920.1 hypothetical protein CICLE_v10013279mg [Citrus clementina] ESR56206.1 hypothetical protein CICLE_v10023214mg [Citrus clementina] ESR56207.1 hypothetical protein CICLE_v10023214mg [Citrus clementina] KGN61359.1 hypothetical protein Csa_2G098440 [Cucumis sativus] Length = 69 Score = 72.8 bits (177), Expect = 1e-15 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 94 MPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 201 MPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV Sbjct: 1 MPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 36 >AFK35386.1 unknown [Lotus japonicus] Length = 69 Score = 72.8 bits (177), Expect = 1e-15 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 94 MPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 201 MPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV Sbjct: 1 MPKQIHEIKDFLLTARRKDARSVKIKRSRDVVKFKV 36