BLASTX nr result
ID: Glycyrrhiza32_contig00017806
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00017806 (207 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIV98648.1 hypothetical protein TanjilG_12771 [Lupinus angustifo... 82 5e-19 AAY41423.1 putative synaptobrevin-like protein, partial [Ipomoea... 82 5e-19 KYP40264.1 Putative vesicle-associated membrane protein 726 fami... 83 8e-19 KHN07197.1 Vesicle-associated membrane protein 722 [Glycine soja] 82 1e-18 XP_016496158.1 PREDICTED: vesicle-associated membrane protein 72... 81 2e-18 XP_019463415.1 PREDICTED: vesicle-associated membrane protein 72... 84 2e-18 OMP08234.1 Synaptobrevin [Corchorus olitorius] 82 3e-18 ONM10426.1 Vesicle-associated membrane protein 722 [Zea mays] 82 3e-18 OMO88900.1 Synaptobrevin [Corchorus capsularis] 82 3e-18 NP_001189664.1 synaptobrevin-related protein 1 [Arabidopsis thal... 81 4e-18 XP_010264069.1 PREDICTED: vesicle-associated membrane protein 72... 83 4e-18 NP_001318921.1 vesicle-associated membrane protein 721 [Arabidop... 81 4e-18 KYP40256.1 Putative vesicle-associated membrane protein 726 fami... 83 4e-18 KJB37799.1 hypothetical protein B456_006G220500 [Gossypium raimo... 82 5e-18 JAU91657.1 hypothetical protein MP_TR26681_c0_g1_i1_g.78067, par... 80 5e-18 XP_007140570.1 hypothetical protein PHAVU_008G123800g [Phaseolus... 82 5e-18 KQL22868.1 hypothetical protein SETIT_031049mg [Setaria italica] 82 6e-18 XP_017609975.1 PREDICTED: putative vesicle-associated membrane p... 83 6e-18 XP_016703024.1 PREDICTED: putative vesicle-associated membrane p... 83 6e-18 XP_016672372.1 PREDICTED: putative vesicle-associated membrane p... 83 6e-18 >OIV98648.1 hypothetical protein TanjilG_12771 [Lupinus angustifolius] Length = 307 Score = 72.4 bits (176), Expect(2) = 5e-19 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +3 Query: 3 VKAQVSEVKEVMMENIEKVIDRGEKIEVLVDKTENLRSQAQDFRR 137 VKAQVSEVK VMMENIEKV+DRGEKIE+LVDKTENLRSQ +DF + Sbjct: 134 VKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQ-EDFTK 177 Score = 49.3 bits (116), Expect(2) = 5e-19 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = +2 Query: 119 GTRFQENMQYCVEHPEEVSNLAKVKAQVS 205 G + +E MQYCV+HPEE+S LAKVKAQVS Sbjct: 197 GPKLKEQMQYCVDHPEEISKLAKVKAQVS 225 Score = 81.6 bits (200), Expect = 6e-17 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = +3 Query: 3 VKAQVSEVKEVMMENIEKVIDRGEKIEVLVDKTENLRSQAQDFRR 137 VKAQVSEVK VMMENIEKV+DRGEKIE+LVDKTENLRSQAQDFR+ Sbjct: 220 VKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQ 264 >AAY41423.1 putative synaptobrevin-like protein, partial [Ipomoea batatas] Length = 87 Score = 82.0 bits (201), Expect = 5e-19 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = +3 Query: 3 VKAQVSEVKEVMMENIEKVIDRGEKIEVLVDKTENLRSQAQDFR 134 VKAQVSEVK VMMENIEKV+DRGEKIE+LVDKTENLRSQAQDFR Sbjct: 1 VKAQVSEVKGVMMENIEKVLDRGEKIEILVDKTENLRSQAQDFR 44 >KYP40264.1 Putative vesicle-associated membrane protein 726 family [Cajanus cajan] Length = 143 Score = 83.2 bits (204), Expect = 8e-19 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = +3 Query: 3 VKAQVSEVKEVMMENIEKVIDRGEKIEVLVDKTENLRSQAQDFRR 137 VKAQVSEVKEVMMENIEKV+DRGEKIEVLVDKTENLR QAQDFR+ Sbjct: 56 VKAQVSEVKEVMMENIEKVLDRGEKIEVLVDKTENLRYQAQDFRQ 100 Score = 51.2 bits (121), Expect = 2e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = +2 Query: 119 GTRFQENMQYCVEHPEEVSNLAKVKAQVS 205 G + +E+MQYCVEHPEEVS LAKVKAQVS Sbjct: 33 GPKLKEHMQYCVEHPEEVSKLAKVKAQVS 61 >KHN07197.1 Vesicle-associated membrane protein 722 [Glycine soja] Length = 104 Score = 81.6 bits (200), Expect = 1e-18 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = +3 Query: 3 VKAQVSEVKEVMMENIEKVIDRGEKIEVLVDKTENLRSQAQDFRR 137 VKAQVSEVK VMMENIEKV+DRGEKIE+LVDKTENLRSQAQDFR+ Sbjct: 17 VKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQ 61 >XP_016496158.1 PREDICTED: vesicle-associated membrane protein 722-like [Nicotiana tabacum] Length = 103 Score = 81.3 bits (199), Expect = 2e-18 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = +3 Query: 3 VKAQVSEVKEVMMENIEKVIDRGEKIEVLVDKTENLRSQAQDFR 134 VKAQVSEVK VMMENIEKV+DRGEKIE+LVDKTENLRSQAQDFR Sbjct: 17 VKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFR 60 >XP_019463415.1 PREDICTED: vesicle-associated membrane protein 721-like [Lupinus angustifolius] OIW01026.1 hypothetical protein TanjilG_14209 [Lupinus angustifolius] Length = 221 Score = 84.0 bits (206), Expect = 2e-18 Identities = 41/45 (91%), Positives = 45/45 (100%) Frame = +3 Query: 3 VKAQVSEVKEVMMENIEKVIDRGEKIEVLVDKTENLRSQAQDFRR 137 V+AQVSEVKEVMMENIEKV+DRGEKIE+LVDKTENLRSQAQDFR+ Sbjct: 134 VRAQVSEVKEVMMENIEKVLDRGEKIEILVDKTENLRSQAQDFRQ 178 >OMP08234.1 Synaptobrevin [Corchorus olitorius] Length = 167 Score = 82.4 bits (202), Expect = 3e-18 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = +3 Query: 3 VKAQVSEVKEVMMENIEKVIDRGEKIEVLVDKTENLRSQAQDFRR 137 VKAQVSEVK VMMENIEKV+DRGEKIE+LVDKTENLRSQAQDFR+ Sbjct: 82 VKAQVSEVKGVMMENIEKVLDRGEKIEILVDKTENLRSQAQDFRQ 126 >ONM10426.1 Vesicle-associated membrane protein 722 [Zea mays] Length = 139 Score = 81.6 bits (200), Expect = 3e-18 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = +3 Query: 3 VKAQVSEVKEVMMENIEKVIDRGEKIEVLVDKTENLRSQAQDFRR 137 VKAQVSEVK VMMENIEKV+DRGEKIE+LVDKTENLRSQAQDFR+ Sbjct: 53 VKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQ 97 Score = 50.8 bits (120), Expect = 3e-06 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = +2 Query: 119 GTRFQENMQYCVEHPEEVSNLAKVKAQVS 205 G++ +E+MQYCV+HPEEVS LAKVKAQVS Sbjct: 30 GSKLKEHMQYCVDHPEEVSKLAKVKAQVS 58 >OMO88900.1 Synaptobrevin [Corchorus capsularis] Length = 171 Score = 82.4 bits (202), Expect = 3e-18 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = +3 Query: 3 VKAQVSEVKEVMMENIEKVIDRGEKIEVLVDKTENLRSQAQDFRR 137 VKAQVSEVK VMMENIEKV+DRGEKIE+LVDKTENLRSQAQDFR+ Sbjct: 86 VKAQVSEVKGVMMENIEKVLDRGEKIEILVDKTENLRSQAQDFRQ 130 >NP_001189664.1 synaptobrevin-related protein 1 [Arabidopsis thaliana] AEC08789.1 synaptobrevin-related protein 1 [Arabidopsis thaliana] Length = 139 Score = 81.3 bits (199), Expect = 4e-18 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = +3 Query: 3 VKAQVSEVKEVMMENIEKVIDRGEKIEVLVDKTENLRSQAQDFR 134 VKAQVSEVK VMMENIEKV+DRGEKIE+LVDKTENLRSQAQDFR Sbjct: 52 VKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFR 95 >XP_010264069.1 PREDICTED: vesicle-associated membrane protein 722 [Nelumbo nucifera] Length = 219 Score = 83.2 bits (204), Expect = 4e-18 Identities = 41/45 (91%), Positives = 45/45 (100%) Frame = +3 Query: 3 VKAQVSEVKEVMMENIEKVIDRGEKIEVLVDKTENLRSQAQDFRR 137 VKAQVSEVKEVMMENIEKV+DRGEKIE+LVDKTENL+SQAQDFR+ Sbjct: 134 VKAQVSEVKEVMMENIEKVLDRGEKIELLVDKTENLKSQAQDFRQ 178 >NP_001318921.1 vesicle-associated membrane protein 721 [Arabidopsis thaliana] NP_001321867.1 vesicle-associated membrane protein 721 [Arabidopsis thaliana] NP_001321868.1 vesicle-associated membrane protein 721 [Arabidopsis thaliana] AEE27739.2 vesicle-associated membrane protein 721 [Arabidopsis thaliana] ANM59513.1 vesicle-associated membrane protein 721 [Arabidopsis thaliana] ANM59514.1 vesicle-associated membrane protein 721 [Arabidopsis thaliana] Length = 141 Score = 81.3 bits (199), Expect = 4e-18 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = +3 Query: 3 VKAQVSEVKEVMMENIEKVIDRGEKIEVLVDKTENLRSQAQDFR 134 VKAQVSEVK VMMENIEKV+DRGEKIE+LVDKTENLRSQAQDFR Sbjct: 56 VKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFR 99 >KYP40256.1 Putative vesicle-associated membrane protein 726 family [Cajanus cajan] Length = 221 Score = 83.2 bits (204), Expect = 4e-18 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = +3 Query: 3 VKAQVSEVKEVMMENIEKVIDRGEKIEVLVDKTENLRSQAQDFRR 137 VKAQVSEVKEVMMENIEKV+DRGEKIEVLVDKTENLR QAQDFR+ Sbjct: 134 VKAQVSEVKEVMMENIEKVLDRGEKIEVLVDKTENLRYQAQDFRQ 178 Score = 51.2 bits (121), Expect = 5e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = +2 Query: 119 GTRFQENMQYCVEHPEEVSNLAKVKAQVS 205 G + +E+MQYCVEHPEEVS LAKVKAQVS Sbjct: 111 GPKLKEHMQYCVEHPEEVSKLAKVKAQVS 139 >KJB37799.1 hypothetical protein B456_006G220500 [Gossypium raimondii] Length = 160 Score = 81.6 bits (200), Expect = 5e-18 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = +3 Query: 3 VKAQVSEVKEVMMENIEKVIDRGEKIEVLVDKTENLRSQAQDFRR 137 VKAQVSEVK VMMENIEKV+DRGEKIE+LVDKTENLRSQAQDFR+ Sbjct: 75 VKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQ 119 Score = 50.4 bits (119), Expect = 6e-06 Identities = 21/29 (72%), Positives = 27/29 (93%) Frame = +2 Query: 119 GTRFQENMQYCVEHPEEVSNLAKVKAQVS 205 G++ +E+MQYCV+HPEE+S LAKVKAQVS Sbjct: 52 GSKLKEHMQYCVDHPEEISKLAKVKAQVS 80 >JAU91657.1 hypothetical protein MP_TR26681_c0_g1_i1_g.78067, partial [Noccaea caerulescens] Length = 108 Score = 80.1 bits (196), Expect = 5e-18 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = +3 Query: 3 VKAQVSEVKEVMMENIEKVIDRGEKIEVLVDKTENLRSQAQDFR 134 VKAQV+EVK VMMENIEKV+DRGEKIE+LVDKTENLRSQAQDFR Sbjct: 62 VKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFR 105 >XP_007140570.1 hypothetical protein PHAVU_008G123800g [Phaseolus vulgaris] ESW12564.1 hypothetical protein PHAVU_008G123800g [Phaseolus vulgaris] Length = 164 Score = 81.6 bits (200), Expect = 5e-18 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = +3 Query: 3 VKAQVSEVKEVMMENIEKVIDRGEKIEVLVDKTENLRSQAQDFRR 137 VKAQVSEVK VMMENIEKV+DRGEKIE+LVDKTENLRSQAQDFR+ Sbjct: 77 VKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQ 121 >KQL22868.1 hypothetical protein SETIT_031049mg [Setaria italica] Length = 168 Score = 81.6 bits (200), Expect = 6e-18 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = +3 Query: 3 VKAQVSEVKEVMMENIEKVIDRGEKIEVLVDKTENLRSQAQDFRR 137 VKAQVSEVK VMMENIEKV+DRGEKIE+LVDKTENLRSQAQDFR+ Sbjct: 80 VKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRQ 124 Score = 50.8 bits (120), Expect = 4e-06 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = +2 Query: 119 GTRFQENMQYCVEHPEEVSNLAKVKAQVS 205 G++ +E+MQYCV+HPEEVS LAKVKAQVS Sbjct: 57 GSKLKEHMQYCVDHPEEVSKLAKVKAQVS 85 >XP_017609975.1 PREDICTED: putative vesicle-associated membrane protein 726 [Gossypium arboreum] XP_017609976.1 PREDICTED: putative vesicle-associated membrane protein 726 [Gossypium arboreum] Length = 219 Score = 82.8 bits (203), Expect = 6e-18 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = +3 Query: 3 VKAQVSEVKEVMMENIEKVIDRGEKIEVLVDKTENLRSQAQDFRR 137 VKAQVSEVK VMMENIEKV+DRGEKIEVLVDKTENLRSQAQDFR+ Sbjct: 134 VKAQVSEVKGVMMENIEKVLDRGEKIEVLVDKTENLRSQAQDFRQ 178 >XP_016703024.1 PREDICTED: putative vesicle-associated membrane protein 726 [Gossypium hirsutum] Length = 219 Score = 82.8 bits (203), Expect = 6e-18 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = +3 Query: 3 VKAQVSEVKEVMMENIEKVIDRGEKIEVLVDKTENLRSQAQDFRR 137 VKAQVSEVK VMMENIEKV+DRGEKIEVLVDKTENLRSQAQDFR+ Sbjct: 134 VKAQVSEVKGVMMENIEKVLDRGEKIEVLVDKTENLRSQAQDFRQ 178 >XP_016672372.1 PREDICTED: putative vesicle-associated membrane protein 726 isoform X1 [Gossypium hirsutum] Length = 219 Score = 82.8 bits (203), Expect = 6e-18 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = +3 Query: 3 VKAQVSEVKEVMMENIEKVIDRGEKIEVLVDKTENLRSQAQDFRR 137 VKAQVSEVK VMMENIEKV+DRGEKIEVLVDKTENLRSQAQDFR+ Sbjct: 134 VKAQVSEVKGVMMENIEKVLDRGEKIEVLVDKTENLRSQAQDFRQ 178