BLASTX nr result
ID: Glycyrrhiza32_contig00017154
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00017154 (308 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN33603.1 Basic form of pathogenesis-related protein 1 [Glycine... 89 4e-20 XP_003593356.2 CAP, cysteine-rich secretory protein, antigen 5, ... 88 8e-20 NP_001237253.1 uncharacterized protein LOC100527778 precursor [G... 87 1e-19 XP_007201461.1 hypothetical protein PRUPE_ppa014001mg [Prunus pe... 84 4e-19 KHN19052.1 Basic form of pathogenesis-related protein 1 [Glycine... 86 4e-19 NP_001238109.1 uncharacterized protein LOC100499927 precursor [G... 86 4e-19 OIV96112.1 hypothetical protein TanjilG_13044 [Lupinus angustifo... 85 1e-18 XP_014518067.1 PREDICTED: basic form of pathogenesis-related pro... 85 1e-18 XP_017435692.1 PREDICTED: basic form of pathogenesis-related pro... 85 1e-18 XP_004486257.2 PREDICTED: basic form of pathogenesis-related pro... 85 1e-18 XP_019425167.1 PREDICTED: basic form of pathogenesis-related pro... 84 1e-18 XP_007148307.1 hypothetical protein PHAVU_006G197500g [Phaseolus... 84 1e-18 XP_019418658.1 PREDICTED: basic form of pathogenesis-related pro... 85 1e-18 KYP48471.1 hypothetical protein KK1_029846 [Cajanus cajan] 84 2e-18 ONH92096.1 hypothetical protein PRUPE_8G155000 [Prunus persica] 84 3e-18 XP_008236150.1 PREDICTED: basic form of pathogenesis-related pro... 84 3e-18 XP_015892937.1 PREDICTED: basic form of pathogenesis-related pro... 83 5e-18 AFK46675.1 unknown [Lotus japonicus] 82 1e-17 XP_019425170.1 PREDICTED: basic form of pathogenesis-related pro... 82 2e-17 XP_015892934.1 PREDICTED: basic form of pathogenesis-related pro... 82 2e-17 >KHN33603.1 Basic form of pathogenesis-related protein 1 [Glycine soja] KRH10678.1 hypothetical protein GLYMA_15G062300 [Glycine max] Length = 161 Score = 88.6 bits (218), Expect = 4e-20 Identities = 35/41 (85%), Positives = 41/41 (100%) Frame = -1 Query: 308 TQIVWRESVHLGCARSKCDNGWVFVICNYSPPGNVEGERPF 186 TQIVWR+SVHLGCAR+KC+NGWVFVIC+YSPPGN+EGERP+ Sbjct: 121 TQIVWRDSVHLGCARAKCNNGWVFVICSYSPPGNIEGERPY 161 >XP_003593356.2 CAP, cysteine-rich secretory protein, antigen 5, partial [Medicago truncatula] AES63607.2 CAP, cysteine-rich secretory protein, antigen 5, partial [Medicago truncatula] Length = 164 Score = 87.8 bits (216), Expect = 8e-20 Identities = 35/41 (85%), Positives = 40/41 (97%) Frame = -1 Query: 308 TQIVWRESVHLGCARSKCDNGWVFVICNYSPPGNVEGERPF 186 TQI+WR+SVHLGCA+SKC NGWVFVIC+YSPPGNVEGERP+ Sbjct: 124 TQIIWRDSVHLGCAKSKCKNGWVFVICSYSPPGNVEGERPY 164 >NP_001237253.1 uncharacterized protein LOC100527778 precursor [Glycine max] ACU16951.1 unknown [Glycine max] Length = 161 Score = 87.0 bits (214), Expect = 1e-19 Identities = 35/41 (85%), Positives = 40/41 (97%) Frame = -1 Query: 308 TQIVWRESVHLGCARSKCDNGWVFVICNYSPPGNVEGERPF 186 TQIVWR SVHLGCAR+KC+NGWVFVIC+YSPPGN+EGERP+ Sbjct: 121 TQIVWRGSVHLGCARAKCNNGWVFVICSYSPPGNIEGERPY 161 >XP_007201461.1 hypothetical protein PRUPE_ppa014001mg [Prunus persica] Length = 91 Score = 84.0 bits (206), Expect = 4e-19 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -1 Query: 308 TQIVWRESVHLGCARSKCDNGWVFVICNYSPPGNVEGERPF 186 TQ+VWR SVHLGCAR+KCDN WVFVIC+Y PPGN EGERP+ Sbjct: 51 TQVVWRNSVHLGCARAKCDNNWVFVICSYDPPGNYEGERPY 91 >KHN19052.1 Basic form of pathogenesis-related protein 1 [Glycine soja] Length = 160 Score = 85.9 bits (211), Expect = 4e-19 Identities = 34/41 (82%), Positives = 40/41 (97%) Frame = -1 Query: 308 TQIVWRESVHLGCARSKCDNGWVFVICNYSPPGNVEGERPF 186 TQIVWR+SVHLGCAR+KC+N WVFVIC+YSPPGN+EGERP+ Sbjct: 120 TQIVWRDSVHLGCARAKCNNDWVFVICSYSPPGNIEGERPY 160 >NP_001238109.1 uncharacterized protein LOC100499927 precursor [Glycine max] ACU14207.1 unknown [Glycine max] KRH21664.1 hypothetical protein GLYMA_13G252600 [Glycine max] Length = 161 Score = 85.9 bits (211), Expect = 4e-19 Identities = 34/41 (82%), Positives = 40/41 (97%) Frame = -1 Query: 308 TQIVWRESVHLGCARSKCDNGWVFVICNYSPPGNVEGERPF 186 TQIVWR+SVHLGCAR+KC+N WVFVIC+YSPPGN+EGERP+ Sbjct: 121 TQIVWRDSVHLGCARAKCNNDWVFVICSYSPPGNIEGERPY 161 >OIV96112.1 hypothetical protein TanjilG_13044 [Lupinus angustifolius] Length = 157 Score = 84.7 bits (208), Expect = 1e-18 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = -1 Query: 308 TQIVWRESVHLGCARSKCDNGWVFVICNYSPPGNVEGERPF 186 TQIVWR+SVH+GCAR+KCDN WVFVIC+Y PPGNVEGERP+ Sbjct: 117 TQIVWRDSVHVGCARAKCDNDWVFVICSYYPPGNVEGERPY 157 >XP_014518067.1 PREDICTED: basic form of pathogenesis-related protein 1-like [Vigna radiata var. radiata] Length = 159 Score = 84.7 bits (208), Expect = 1e-18 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = -1 Query: 308 TQIVWRESVHLGCARSKCDNGWVFVICNYSPPGNVEGERPF 186 TQIVWR S+HLGCAR+KC+NGW+FVIC+YSPPGN EGERP+ Sbjct: 119 TQIVWRNSIHLGCARAKCNNGWMFVICSYSPPGNYEGERPY 159 >XP_017435692.1 PREDICTED: basic form of pathogenesis-related protein 1-like [Vigna angularis] KOM53899.1 hypothetical protein LR48_Vigan09g255800 [Vigna angularis] BAT86959.1 hypothetical protein VIGAN_05029200 [Vigna angularis var. angularis] Length = 159 Score = 84.7 bits (208), Expect = 1e-18 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = -1 Query: 308 TQIVWRESVHLGCARSKCDNGWVFVICNYSPPGNVEGERPF 186 TQIVWR S+HLGCAR+KC+NGW+FVIC+YSPPGN EGERP+ Sbjct: 119 TQIVWRNSIHLGCARAKCNNGWMFVICSYSPPGNYEGERPY 159 >XP_004486257.2 PREDICTED: basic form of pathogenesis-related protein 1-like [Cicer arietinum] Length = 159 Score = 84.7 bits (208), Expect = 1e-18 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = -1 Query: 308 TQIVWRESVHLGCARSKCDNGWVFVICNYSPPGNVEGERPF 186 TQI+W +SVHLGCA+SKC NGWVFVIC+YSPPGNVEG+RP+ Sbjct: 119 TQIIWSDSVHLGCAKSKCQNGWVFVICSYSPPGNVEGQRPY 159 >XP_019425167.1 PREDICTED: basic form of pathogenesis-related protein 1-like [Lupinus angustifolius] OIV91604.1 hypothetical protein TanjilG_09016 [Lupinus angustifolius] Length = 157 Score = 84.3 bits (207), Expect = 1e-18 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = -1 Query: 308 TQIVWRESVHLGCARSKCDNGWVFVICNYSPPGNVEGERPF 186 TQIVWR+SVHLGCAR+KCDN WVFVIC+YSPPGNV G+RP+ Sbjct: 117 TQIVWRDSVHLGCARAKCDNNWVFVICSYSPPGNVIGQRPY 157 >XP_007148307.1 hypothetical protein PHAVU_006G197500g [Phaseolus vulgaris] ESW20301.1 hypothetical protein PHAVU_006G197500g [Phaseolus vulgaris] Length = 157 Score = 84.3 bits (207), Expect = 1e-18 Identities = 34/41 (82%), Positives = 40/41 (97%) Frame = -1 Query: 308 TQIVWRESVHLGCARSKCDNGWVFVICNYSPPGNVEGERPF 186 TQIVWR+SV+LGCAR+KC NGW+FVIC+YSPPGNVEGERP+ Sbjct: 117 TQIVWRDSVNLGCARAKCKNGWMFVICSYSPPGNVEGERPY 157 >XP_019418658.1 PREDICTED: basic form of pathogenesis-related protein 1-like [Lupinus angustifolius] Length = 173 Score = 84.7 bits (208), Expect = 1e-18 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = -1 Query: 308 TQIVWRESVHLGCARSKCDNGWVFVICNYSPPGNVEGERPF 186 TQIVWR+SVH+GCAR+KCDN WVFVIC+Y PPGNVEGERP+ Sbjct: 133 TQIVWRDSVHVGCARAKCDNDWVFVICSYYPPGNVEGERPY 173 >KYP48471.1 hypothetical protein KK1_029846 [Cajanus cajan] Length = 162 Score = 84.0 bits (206), Expect = 2e-18 Identities = 31/41 (75%), Positives = 41/41 (100%) Frame = -1 Query: 308 TQIVWRESVHLGCARSKCDNGWVFVICNYSPPGNVEGERPF 186 TQIVWR+S+HLGCA++KC+NGWVF+IC+YSPPGN++GERP+ Sbjct: 122 TQIVWRDSLHLGCAKAKCNNGWVFLICSYSPPGNIQGERPY 162 >ONH92096.1 hypothetical protein PRUPE_8G155000 [Prunus persica] Length = 169 Score = 84.0 bits (206), Expect = 3e-18 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -1 Query: 308 TQIVWRESVHLGCARSKCDNGWVFVICNYSPPGNVEGERPF 186 TQ+VWR SVHLGCAR+KCDN WVFVIC+Y PPGN EGERP+ Sbjct: 129 TQVVWRNSVHLGCARAKCDNNWVFVICSYDPPGNYEGERPY 169 >XP_008236150.1 PREDICTED: basic form of pathogenesis-related protein 1-like [Prunus mume] Length = 169 Score = 84.0 bits (206), Expect = 3e-18 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -1 Query: 308 TQIVWRESVHLGCARSKCDNGWVFVICNYSPPGNVEGERPF 186 TQ+VWR SVHLGCAR+KCDN WVFVIC+Y PPGN EGERP+ Sbjct: 129 TQVVWRNSVHLGCARAKCDNNWVFVICSYDPPGNYEGERPY 169 >XP_015892937.1 PREDICTED: basic form of pathogenesis-related protein 1-like [Ziziphus jujuba] XP_015892938.1 PREDICTED: basic form of pathogenesis-related protein 1-like [Ziziphus jujuba] Length = 164 Score = 83.2 bits (204), Expect = 5e-18 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -1 Query: 308 TQIVWRESVHLGCARSKCDNGWVFVICNYSPPGNVEGERPF 186 TQ+VWR+SVHLGCAR KC NGW+FVICNY PPGN EGERP+ Sbjct: 124 TQVVWRKSVHLGCARVKCRNGWMFVICNYDPPGNYEGERPY 164 >AFK46675.1 unknown [Lotus japonicus] Length = 164 Score = 82.0 bits (201), Expect = 1e-17 Identities = 31/41 (75%), Positives = 38/41 (92%) Frame = -1 Query: 308 TQIVWRESVHLGCARSKCDNGWVFVICNYSPPGNVEGERPF 186 TQ+VWR+SVHLGCA+SKC+NGWVFV+CNY PPGN G+RP+ Sbjct: 124 TQMVWRDSVHLGCAKSKCNNGWVFVVCNYDPPGNYVGDRPY 164 >XP_019425170.1 PREDICTED: basic form of pathogenesis-related protein 1-like [Lupinus angustifolius] OIV91603.1 hypothetical protein TanjilG_09015 [Lupinus angustifolius] Length = 157 Score = 81.6 bits (200), Expect = 2e-17 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -1 Query: 308 TQIVWRESVHLGCARSKCDNGWVFVICNYSPPGNVEGERPF 186 TQIVWR SV+LGCAR KCDN WVFVICNYSPPGN GERP+ Sbjct: 117 TQIVWRNSVYLGCARVKCDNNWVFVICNYSPPGNYMGERPY 157 >XP_015892934.1 PREDICTED: basic form of pathogenesis-related protein 1-like [Ziziphus jujuba] Length = 165 Score = 81.6 bits (200), Expect = 2e-17 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -1 Query: 308 TQIVWRESVHLGCARSKCDNGWVFVICNYSPPGNVEGERPF 186 TQ+VWR+SVHLGCAR KC NGW+FVIC+Y PPGN EGERP+ Sbjct: 125 TQVVWRKSVHLGCARVKCHNGWMFVICSYDPPGNYEGERPY 165