BLASTX nr result
ID: Glycyrrhiza32_contig00017066
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00017066 (232 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_020179284.1 hypothetical protein [Methylopila sp. M107] 52 5e-06 >WP_020179284.1 hypothetical protein [Methylopila sp. M107] Length = 204 Score = 51.6 bits (122), Expect = 5e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = +3 Query: 132 VNALDVFVNCPFDPIYKPIFNAIVFVVVRSGYR 230 +N LD F+NCPFD YKP+F AIVF +VR G+R Sbjct: 1 MNDLDAFINCPFDGEYKPMFQAIVFTIVRCGFR 33