BLASTX nr result
ID: Glycyrrhiza32_contig00016724
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00016724 (395 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU20014.1 hypothetical protein TSUD_273490 [Trifolium subterran... 52 8e-06 >GAU20014.1 hypothetical protein TSUD_273490 [Trifolium subterraneum] Length = 159 Score = 52.4 bits (124), Expect = 8e-06 Identities = 22/42 (52%), Positives = 30/42 (71%) Frame = -3 Query: 393 ILMAELWGIDSALRFAWDNGIQQFVVESESAVAIHLILKGCP 268 +LMAELWGI + L+ WD G + +ES+SA+ + LI KGCP Sbjct: 51 VLMAELWGILTTLQMVWDKGYRYVSLESDSAIVVSLINKGCP 92