BLASTX nr result
ID: Glycyrrhiza32_contig00016592
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00016592 (207 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU48394.1 hypothetical protein TSUD_118200 [Trifolium subterran... 52 3e-06 >GAU48394.1 hypothetical protein TSUD_118200 [Trifolium subterraneum] Length = 340 Score = 52.4 bits (124), Expect = 3e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +2 Query: 2 LNKIAVDVDPTVSAQMDALIERVRDFIQKH 91 LNKIAVD+DP VSAQMDALI R+++FI+KH Sbjct: 311 LNKIAVDIDPAVSAQMDALIGRIKEFIEKH 340