BLASTX nr result
ID: Glycyrrhiza32_contig00016390
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00016390 (426 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019446358.1 PREDICTED: ethylene-responsive transcription fact... 80 2e-15 OIW16082.1 hypothetical protein TanjilG_00039 [Lupinus angustifo... 77 2e-14 XP_004503470.1 PREDICTED: ethylene-responsive transcription fact... 75 1e-13 XP_018814845.1 PREDICTED: dehydration-responsive element-binding... 75 1e-13 APQ47411.1 AP2/ERF domain-containing transcription factor [Verni... 69 2e-12 XP_008242523.1 PREDICTED: dehydration-responsive element-binding... 72 3e-12 XP_007202464.1 hypothetical protein PRUPE_ppa010130mg [Prunus pe... 71 4e-12 XP_003530573.1 PREDICTED: ethylene-responsive transcription fact... 70 6e-12 APQ47331.1 AP2/ERF domain-containing transcription factor [Verni... 69 2e-11 OAY53810.1 hypothetical protein MANES_03G025200 [Manihot esculenta] 69 2e-11 XP_007160302.1 hypothetical protein PHAVU_002G310200g [Phaseolus... 68 4e-11 XP_002514246.1 PREDICTED: ethylene-responsive transcription fact... 69 4e-11 XP_008462760.1 PREDICTED: ethylene-responsive transcription fact... 68 4e-11 XP_017221967.1 PREDICTED: dehydration-responsive element-binding... 67 5e-11 XP_003630740.2 ethylene response factor [Medicago truncatula] AE... 68 5e-11 XP_009352529.1 PREDICTED: ethylene-responsive transcription fact... 68 6e-11 OAY53051.1 hypothetical protein MANES_04G131900 [Manihot esculenta] 67 7e-11 XP_010051579.1 PREDICTED: ethylene-responsive transcription fact... 67 7e-11 KYP61651.1 Dehydration-responsive element-binding protein 3, par... 67 8e-11 XP_002280555.2 PREDICTED: dehydration-responsive element-binding... 67 1e-10 >XP_019446358.1 PREDICTED: ethylene-responsive transcription factor TINY-like [Lupinus angustifolius] OIW09996.1 hypothetical protein TanjilG_32736 [Lupinus angustifolius] Length = 250 Score = 79.7 bits (195), Expect = 2e-15 Identities = 40/52 (76%), Positives = 44/52 (84%), Gaps = 1/52 (1%) Frame = -3 Query: 154 PKASPSYSEPQSPDPNGKRPK-RAREISNSKHPVYRGVRMRAWGKWVSEIRE 2 PKAS SEPQ PDP+ K+PK R R+ SNSKHPV+RGVRMRAWGKWVSEIRE Sbjct: 32 PKAS--LSEPQIPDPDKKKPKKRPRDSSNSKHPVFRGVRMRAWGKWVSEIRE 81 >OIW16082.1 hypothetical protein TanjilG_00039 [Lupinus angustifolius] Length = 239 Score = 77.0 bits (188), Expect = 2e-14 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 139 SYSEPQSPDPNGKRPKRAREISNSKHPVYRGVRMRAWGKWVSEIRE 2 S+SEPQ P+P+ K+PK+ SN+ HPVYRGVRMRAWGKWVSEIRE Sbjct: 32 SFSEPQLPEPDHKKPKKRSRDSNTNHPVYRGVRMRAWGKWVSEIRE 77 >XP_004503470.1 PREDICTED: ethylene-responsive transcription factor TINY-like [Cicer arietinum] Length = 227 Score = 74.7 bits (182), Expect = 1e-13 Identities = 37/48 (77%), Positives = 38/48 (79%), Gaps = 2/48 (4%) Frame = -3 Query: 139 SYSEPQSPDPNGKRPKRAREISN--SKHPVYRGVRMRAWGKWVSEIRE 2 S SE PDP KRPKR RE +N SKHPVYRGVRMRAWGKWVSEIRE Sbjct: 19 SCSEVHLPDPEQKRPKRPRESNNTNSKHPVYRGVRMRAWGKWVSEIRE 66 >XP_018814845.1 PREDICTED: dehydration-responsive element-binding protein 3-like [Juglans regia] Length = 257 Score = 75.1 bits (183), Expect = 1e-13 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = -3 Query: 145 SPSYSEPQSPDPNGKRPKRAREISNSKHPVYRGVRMRAWGKWVSEIRE 2 +P+Y E SPDP+ K+PKRAR+ +SKH VYRGVRMR+WGKWVSEIRE Sbjct: 38 NPTYKESSSPDPDPKQPKRARD--SSKHAVYRGVRMRSWGKWVSEIRE 83 >APQ47411.1 AP2/ERF domain-containing transcription factor [Vernicia fordii] Length = 130 Score = 69.3 bits (168), Expect = 2e-12 Identities = 36/59 (61%), Positives = 41/59 (69%), Gaps = 8/59 (13%) Frame = -3 Query: 154 PKASPSYSEPQSPDP--------NGKRPKRAREISNSKHPVYRGVRMRAWGKWVSEIRE 2 P SPS S SP+P N ++PKRAR+ +SKHPVYRGVRMR WGKWVSEIRE Sbjct: 23 PPCSPSSSSGLSPNPVLRSDPDDNPRKPKRARD--SSKHPVYRGVRMRTWGKWVSEIRE 79 >XP_008242523.1 PREDICTED: dehydration-responsive element-binding protein 3 [Prunus mume] Length = 282 Score = 71.6 bits (174), Expect = 3e-12 Identities = 35/48 (72%), Positives = 37/48 (77%) Frame = -3 Query: 145 SPSYSEPQSPDPNGKRPKRAREISNSKHPVYRGVRMRAWGKWVSEIRE 2 +P SPDP+ KR KRARE S SKHPVYRGVRMR WGKWVSEIRE Sbjct: 36 NPLPGSSDSPDPDQKRAKRARETS-SKHPVYRGVRMRTWGKWVSEIRE 82 >XP_007202464.1 hypothetical protein PRUPE_ppa010130mg [Prunus persica] ONH98000.1 hypothetical protein PRUPE_7G222700 [Prunus persica] Length = 262 Score = 71.2 bits (173), Expect = 4e-12 Identities = 35/48 (72%), Positives = 37/48 (77%) Frame = -3 Query: 145 SPSYSEPQSPDPNGKRPKRAREISNSKHPVYRGVRMRAWGKWVSEIRE 2 +P SPDP+ KR KRARE S SKHPVYRGVRMR WGKWVSEIRE Sbjct: 36 NPLPGSSDSPDPDQKRVKRARETS-SKHPVYRGVRMRTWGKWVSEIRE 82 >XP_003530573.1 PREDICTED: ethylene-responsive transcription factor TINY-like [Glycine max] KRH41516.1 hypothetical protein GLYMA_08G035000 [Glycine max] Length = 242 Score = 70.5 bits (171), Expect = 6e-12 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = -3 Query: 139 SYSEPQSPDPNGKRPKRAREISNSKHPVYRGVRMRAWGKWVSEIRE 2 S SE P P+ KRPK+AR+ S+SKHPV+RGVRMRAWGKWVSEIRE Sbjct: 20 SSSEAHLPAPDQKRPKQARD-SSSKHPVFRGVRMRAWGKWVSEIRE 64 >APQ47331.1 AP2/ERF domain-containing transcription factor [Vernicia montana] Length = 259 Score = 69.3 bits (168), Expect = 2e-11 Identities = 36/59 (61%), Positives = 41/59 (69%), Gaps = 8/59 (13%) Frame = -3 Query: 154 PKASPSYSEPQSPDP--------NGKRPKRAREISNSKHPVYRGVRMRAWGKWVSEIRE 2 P SPS S SP+P N ++PKRAR+ +SKHPVYRGVRMR WGKWVSEIRE Sbjct: 23 PPCSPSSSSGLSPNPVLRSDPDDNPRKPKRARD--SSKHPVYRGVRMRTWGKWVSEIRE 79 >OAY53810.1 hypothetical protein MANES_03G025200 [Manihot esculenta] Length = 279 Score = 69.3 bits (168), Expect = 2e-11 Identities = 37/57 (64%), Positives = 41/57 (71%), Gaps = 8/57 (14%) Frame = -3 Query: 148 ASPSYSEPQSPDP--------NGKRPKRAREISNSKHPVYRGVRMRAWGKWVSEIRE 2 +SPS S SP+P N +RPKRAR+ NSKHPVYRGVRMR WGKWVSEIRE Sbjct: 29 SSPSSSGLLSPNPVNKPCSEENPRRPKRARD--NSKHPVYRGVRMRTWGKWVSEIRE 83 >XP_007160302.1 hypothetical protein PHAVU_002G310200g [Phaseolus vulgaris] ESW32296.1 hypothetical protein PHAVU_002G310200g [Phaseolus vulgaris] Length = 242 Score = 68.2 bits (165), Expect = 4e-11 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = -3 Query: 139 SYSEPQSPDPNGKRPKRAREISNSKHPVYRGVRMRAWGKWVSEIRE 2 S SE P+ KRPK+AR+ S+SKHPVYRGVRMR+WGKWVSEIRE Sbjct: 19 SSSEAHLEGPDQKRPKQARD-SSSKHPVYRGVRMRSWGKWVSEIRE 63 >XP_002514246.1 PREDICTED: ethylene-responsive transcription factor TINY [Ricinus communis] EEF48200.1 Transcriptional factor TINY, putative [Ricinus communis] Length = 279 Score = 68.6 bits (166), Expect = 4e-11 Identities = 32/48 (66%), Positives = 37/48 (77%) Frame = -3 Query: 145 SPSYSEPQSPDPNGKRPKRAREISNSKHPVYRGVRMRAWGKWVSEIRE 2 SP+ P+ N ++PKRAR+ SN KHPVYRGVRMR WGKWVSEIRE Sbjct: 39 SPNPVRKPGPEENPRKPKRARDSSN-KHPVYRGVRMRTWGKWVSEIRE 85 >XP_008462760.1 PREDICTED: ethylene-responsive transcription factor TINY-like [Cucumis melo] Length = 250 Score = 68.2 bits (165), Expect = 4e-11 Identities = 37/56 (66%), Positives = 40/56 (71%), Gaps = 5/56 (8%) Frame = -3 Query: 154 PKASPSYSEPQSPDP----NGKRPKRAREISN-SKHPVYRGVRMRAWGKWVSEIRE 2 P +S S S P S P N KR KR RE +N SKHPV+RGVRMRAWGKWVSEIRE Sbjct: 16 PSSSGSLSPPSSSSPVVESNRKRLKRPRENNNNSKHPVFRGVRMRAWGKWVSEIRE 71 >XP_017221967.1 PREDICTED: dehydration-responsive element-binding protein 3-like [Daucus carota subsp. sativus] KZM83904.1 hypothetical protein DCAR_028674 [Daucus carota subsp. sativus] Length = 210 Score = 67.4 bits (163), Expect = 5e-11 Identities = 32/45 (71%), Positives = 34/45 (75%), Gaps = 3/45 (6%) Frame = -3 Query: 127 PQSPDPNGKRPKR---AREISNSKHPVYRGVRMRAWGKWVSEIRE 2 P SPDPN KR KR A + +KHPVYRGVRMR WGKWVSEIRE Sbjct: 12 PISPDPNAKRAKRSPAASPTNGTKHPVYRGVRMRTWGKWVSEIRE 56 >XP_003630740.2 ethylene response factor [Medicago truncatula] AET05216.2 ethylene response factor [Medicago truncatula] Length = 235 Score = 67.8 bits (164), Expect = 5e-11 Identities = 36/51 (70%), Positives = 36/51 (70%) Frame = -3 Query: 154 PKASPSYSEPQSPDPNGKRPKRAREISNSKHPVYRGVRMRAWGKWVSEIRE 2 PK S S PDP KRPKR RE S HPVYRGVRMRAWGKWVSEIRE Sbjct: 10 PKTS---SSAHLPDPVEKRPKRPRE---SNHPVYRGVRMRAWGKWVSEIRE 54 >XP_009352529.1 PREDICTED: ethylene-responsive transcription factor TINY [Pyrus x bretschneideri] Length = 277 Score = 68.2 bits (165), Expect = 6e-11 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = -3 Query: 121 SPDPNGKRPKRAREISNSKHPVYRGVRMRAWGKWVSEIRE 2 SP P+ KR KRARE S SKHPVYRGVRMR WGKWVSEIRE Sbjct: 46 SPGPDQKRAKRARETS-SKHPVYRGVRMRTWGKWVSEIRE 84 >OAY53051.1 hypothetical protein MANES_04G131900 [Manihot esculenta] Length = 231 Score = 67.4 bits (163), Expect = 7e-11 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = -3 Query: 148 ASPSYSEPQSPDPNGKRPKRAREISNSKHPVYRGVRMRAWGKWVSEIRE 2 A+PS S+ Q DP + PKRAR+ SKHPVYRGVRMR+WGKWVSEIRE Sbjct: 25 AAPSKSKAQ--DPEDRTPKRARD---SKHPVYRGVRMRSWGKWVSEIRE 68 >XP_010051579.1 PREDICTED: ethylene-responsive transcription factor TINY [Eucalyptus grandis] KCW82378.1 hypothetical protein EUGRSUZ_C03785 [Eucalyptus grandis] Length = 233 Score = 67.4 bits (163), Expect = 7e-11 Identities = 30/49 (61%), Positives = 35/49 (71%) Frame = -3 Query: 148 ASPSYSEPQSPDPNGKRPKRAREISNSKHPVYRGVRMRAWGKWVSEIRE 2 A P S P SP + +P+ R +SKHPVYRGVRMRAWG+WVSEIRE Sbjct: 2 AGPKNSSPPSPSQSTTKPRPKRARDSSKHPVYRGVRMRAWGRWVSEIRE 50 >KYP61651.1 Dehydration-responsive element-binding protein 3, partial [Cajanus cajan] Length = 248 Score = 67.4 bits (163), Expect = 8e-11 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = -3 Query: 139 SYSEPQSPDPNGKRPKRAREISNSKHPVYRGVRMRAWGKWVSEIRE 2 S SE Q P+ K+PK+A + S+SKHPVYRGVRMRAWGKWVSEIRE Sbjct: 29 SSSEAQLAGPDHKKPKQAPD-SSSKHPVYRGVRMRAWGKWVSEIRE 73 >XP_002280555.2 PREDICTED: dehydration-responsive element-binding protein 3 [Vitis vinifera] Length = 266 Score = 67.0 bits (162), Expect = 1e-10 Identities = 35/57 (61%), Positives = 41/57 (71%), Gaps = 8/57 (14%) Frame = -3 Query: 148 ASPSYSEPQSP--------DPNGKRPKRAREISNSKHPVYRGVRMRAWGKWVSEIRE 2 +SPS S Q+P DP+ +RPKR R+ +SKHPVYRGVRMR WGKWVSEIRE Sbjct: 17 SSPSSSGIQNPPAKRSKTSDPDQERPKRGRD--SSKHPVYRGVRMRTWGKWVSEIRE 71