BLASTX nr result
ID: Glycyrrhiza32_contig00016348
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00016348 (414 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007146495.1 hypothetical protein PHAVU_006G045500g, partial [... 64 6e-11 KHM99552.1 hypothetical protein glysoja_006395, partial [Glycine... 62 3e-10 >XP_007146495.1 hypothetical protein PHAVU_006G045500g, partial [Phaseolus vulgaris] ESW18489.1 hypothetical protein PHAVU_006G045500g, partial [Phaseolus vulgaris] Length = 61 Score = 63.5 bits (153), Expect = 6e-11 Identities = 30/52 (57%), Positives = 40/52 (76%), Gaps = 2/52 (3%) Frame = +1 Query: 40 NSVNIWLCLSFVAFLN--PQNPKTLYAMVMFVFSEIGRSINQKNPRASNSKA 189 +S++ WLCLSF ++ P +PK+LYAMVMF SEIGRS +NPRASNS++ Sbjct: 10 SSISSWLCLSFAVAVSQIPHSPKSLYAMVMFACSEIGRSTRPRNPRASNSRS 61 >KHM99552.1 hypothetical protein glysoja_006395, partial [Glycine soja] Length = 78 Score = 62.0 bits (149), Expect = 3e-10 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 2/61 (3%) Frame = +1 Query: 4 LVLFLSIGS*NLNSVNIWLCLSFVAF--LNPQNPKTLYAMVMFVFSEIGRSINQKNPRAS 177 ++ FL + S + ++ WLCLSF L+PQNPK+LYAMVMF SEIGRS KNPRA+ Sbjct: 3 ILSFLYVAS---SLISPWLCLSFAVAVSLSPQNPKSLYAMVMFACSEIGRSTKPKNPRAT 59 Query: 178 N 180 + Sbjct: 60 S 60