BLASTX nr result
ID: Glycyrrhiza32_contig00016341
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00016341 (213 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH11341.1 hypothetical protein GLYMA_15G101700 [Glycine max] 79 1e-15 NP_001304395.1 F-box/kelch-repeat protein At3g23880-like [Glycin... 79 1e-15 XP_013464668.1 F-box protein interaction domain protein [Medicag... 77 4e-15 XP_003599217.1 F-box protein interaction domain protein [Medicag... 72 2e-13 XP_003594508.2 F-box protein interaction domain protein [Medicag... 70 2e-12 XP_013452619.1 F-box protein interaction domain protein [Medicag... 70 2e-12 GAU20087.1 hypothetical protein TSUD_381790 [Trifolium subterran... 70 3e-12 XP_003594087.1 F-box protein interaction domain protein [Medicag... 69 4e-12 XP_013464670.1 F-box protein interaction domain protein [Medicag... 69 6e-12 XP_013443080.1 F-box protein interaction domain protein [Medicag... 69 6e-12 XP_013467788.1 F-box protein interaction domain protein [Medicag... 69 6e-12 XP_013458776.1 F-box protein interaction domain protein [Medicag... 69 6e-12 XP_013459073.1 F-box protein interaction domain protein [Medicag... 68 9e-12 XP_019420066.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 68 1e-11 XP_004486107.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 67 2e-11 XP_013470399.1 F-box protein interaction domain protein [Medicag... 67 3e-11 GAU20086.1 hypothetical protein TSUD_381780 [Trifolium subterran... 67 3e-11 GAU20090.1 hypothetical protein TSUD_381820 [Trifolium subterran... 66 4e-11 XP_003599216.1 F-box protein interaction domain protein [Medicag... 66 6e-11 XP_013470353.1 F-box protein interaction domain protein [Medicag... 65 8e-11 >KRH11341.1 hypothetical protein GLYMA_15G101700 [Glycine max] Length = 393 Score = 79.0 bits (193), Expect = 1e-15 Identities = 44/71 (61%), Positives = 51/71 (71%) Frame = -1 Query: 213 YKVVAVFCLDQYVRDKTQVCIYTLGTDSWRTIQEYPYHALGDRAGIFVSGTVNWLAFAAS 34 YKVVA+FC + R +TQV + TLGTDSWR IQE+P D +G FVSGTVNWLA S Sbjct: 198 YKVVAIFCYECDGRYETQVKVLTLGTDSWRRIQEFPSGLPFDESGKFVSGTVNWLASNDS 257 Query: 33 SSWPVIVSLDL 1 SS +IVSLDL Sbjct: 258 SSL-IIVSLDL 267 >NP_001304395.1 F-box/kelch-repeat protein At3g23880-like [Glycine max] ACU22680.1 unknown [Glycine max] Length = 393 Score = 79.0 bits (193), Expect = 1e-15 Identities = 44/71 (61%), Positives = 51/71 (71%) Frame = -1 Query: 213 YKVVAVFCLDQYVRDKTQVCIYTLGTDSWRTIQEYPYHALGDRAGIFVSGTVNWLAFAAS 34 YKVVA+FC + R +TQV + TLGTDSWR IQE+P D +G FVSGTVNWLA S Sbjct: 198 YKVVAIFCYECDGRYETQVKVLTLGTDSWRRIQEFPSGLPFDESGKFVSGTVNWLASNDS 257 Query: 33 SSWPVIVSLDL 1 SS +IVSLDL Sbjct: 258 SSL-IIVSLDL 267 >XP_013464668.1 F-box protein interaction domain protein [Medicago truncatula] KEH38703.1 F-box protein interaction domain protein [Medicago truncatula] Length = 310 Score = 77.0 bits (188), Expect = 4e-15 Identities = 39/71 (54%), Positives = 51/71 (71%) Frame = -1 Query: 213 YKVVAVFCLDQYVRDKTQVCIYTLGTDSWRTIQEYPYHALGDRAGIFVSGTVNWLAFAAS 34 YK+VAV V D+ +V ++TLGTD+WR I ++PY+ DR GIF+SGTVNW++F Sbjct: 111 YKIVAV----SLVEDREEVSVHTLGTDTWRRIPDFPYNGPFDRFGIFLSGTVNWMSFDNV 166 Query: 33 SSWPVIVSLDL 1 SS VIVSLDL Sbjct: 167 SSSCVIVSLDL 177 >XP_003599217.1 F-box protein interaction domain protein [Medicago truncatula] AES69468.1 F-box protein interaction domain protein [Medicago truncatula] Length = 301 Score = 72.0 bits (175), Expect = 2e-13 Identities = 35/72 (48%), Positives = 51/72 (70%), Gaps = 1/72 (1%) Frame = -1 Query: 213 YKVVAVFCLDQYVRDKTQVCIYTLGTDSWRTIQEYPYHALGDRAGIFVSGTVNWLAFAAS 34 YK+VAV + +++ +V +YTLGT++WR IQ++PY + D G+FVSGT+NWL++ S Sbjct: 101 YKIVAV----SFFKNQYRVSVYTLGTNTWRRIQDFPYSHISDNPGVFVSGTINWLSYDIS 156 Query: 33 SS-WPVIVSLDL 1 S IVSLDL Sbjct: 157 SRLLNAIVSLDL 168 >XP_003594508.2 F-box protein interaction domain protein [Medicago truncatula] AES64759.2 F-box protein interaction domain protein [Medicago truncatula] Length = 405 Score = 70.1 bits (170), Expect = 2e-12 Identities = 40/73 (54%), Positives = 50/73 (68%), Gaps = 2/73 (2%) Frame = -1 Query: 213 YKVVAVFCLDQYVRD-KTQVCIYTLGTDSWRTIQEYPYHALGDRAGIFVSGTVNWLAFAA 37 YKVVAV+C + D KTQV ++TLGT+ WR I + P+ D +G FVSGTVNWLA Sbjct: 204 YKVVAVYCFESDNGDYKTQVKVHTLGTNFWRRIHDLPFGVPFDESGKFVSGTVNWLASND 263 Query: 36 SS-SWPVIVSLDL 1 SS + +IVSLDL Sbjct: 264 SSYTSSIIVSLDL 276 >XP_013452619.1 F-box protein interaction domain protein [Medicago truncatula] KEH26647.1 F-box protein interaction domain protein [Medicago truncatula] Length = 361 Score = 69.7 bits (169), Expect = 2e-12 Identities = 38/71 (53%), Positives = 48/71 (67%) Frame = -1 Query: 213 YKVVAVFCLDQYVRDKTQVCIYTLGTDSWRTIQEYPYHALGDRAGIFVSGTVNWLAFAAS 34 YK+VA+ KT++ ++TLGTDSWRTIQ++PY R GIFVSGT+NWL Sbjct: 163 YKIVAI----SGRFGKTKISVHTLGTDSWRTIQDFPYSRQLHRLGIFVSGTINWLVVDDG 218 Query: 33 SSWPVIVSLDL 1 SS+ IVSLDL Sbjct: 219 SSF-FIVSLDL 228 >GAU20087.1 hypothetical protein TSUD_381790 [Trifolium subterraneum] Length = 436 Score = 69.7 bits (169), Expect = 3e-12 Identities = 41/76 (53%), Positives = 46/76 (60%), Gaps = 5/76 (6%) Frame = -1 Query: 213 YKVVAVFCLDQYVRD-----KTQVCIYTLGTDSWRTIQEYPYHALGDRAGIFVSGTVNWL 49 YKVVAV D Y D KT+V +YTLGT SWR IQ++PY G FVSGTVNW Sbjct: 224 YKVVAVNHYDAYRSDNDVISKTRVKVYTLGTSSWRMIQDFPYGIPLHPCGTFVSGTVNWW 283 Query: 48 AFAASSSWPVIVSLDL 1 S + VIVSLDL Sbjct: 284 VTNGSHTSRVIVSLDL 299 >XP_003594087.1 F-box protein interaction domain protein [Medicago truncatula] AES64338.1 F-box protein interaction domain protein [Medicago truncatula] Length = 375 Score = 68.9 bits (167), Expect = 4e-12 Identities = 38/77 (49%), Positives = 47/77 (61%), Gaps = 6/77 (7%) Frame = -1 Query: 213 YKVVAVFCLDQYVRD------KTQVCIYTLGTDSWRTIQEYPYHALGDRAGIFVSGTVNW 52 YKVVAV C + KT+V +YTLGTD WR IQ++P D +G FVSGT+NW Sbjct: 172 YKVVAVNCFESDTDSNGSKVYKTEVKVYTLGTDYWRRIQDFPSGVPFDNSGTFVSGTINW 231 Query: 51 LAFAASSSWPVIVSLDL 1 LA + +IVSLDL Sbjct: 232 LAAKDPYTSWIIVSLDL 248 >XP_013464670.1 F-box protein interaction domain protein [Medicago truncatula] KEH38705.1 F-box protein interaction domain protein [Medicago truncatula] Length = 358 Score = 68.6 bits (166), Expect = 6e-12 Identities = 36/71 (50%), Positives = 46/71 (64%) Frame = -1 Query: 213 YKVVAVFCLDQYVRDKTQVCIYTLGTDSWRTIQEYPYHALGDRAGIFVSGTVNWLAFAAS 34 YK+VA+ V D+ +V ++TLGTD+WR I ++PY GIFV GTVNWL+ Sbjct: 186 YKIVAI----SLVEDREEVSVHTLGTDTWRRIPDFPYSGPFCGYGIFVGGTVNWLSLDEV 241 Query: 33 SSWPVIVSLDL 1 SS VIVSLDL Sbjct: 242 SSLCVIVSLDL 252 >XP_013443080.1 F-box protein interaction domain protein [Medicago truncatula] KEH17105.1 F-box protein interaction domain protein [Medicago truncatula] Length = 392 Score = 68.6 bits (166), Expect = 6e-12 Identities = 38/75 (50%), Positives = 51/75 (68%), Gaps = 4/75 (5%) Frame = -1 Query: 213 YKVVAVF-CLDQYVRDKTQVCIYTLGTDSWRTIQEYPYHALGDRAGIFVSGTVNWLAF-- 43 YK++ V C++ K++VCI TLGTD WR I+++PY +GIFVSGTVNWLA Sbjct: 193 YKIIVVSSCIN-----KSEVCILTLGTDYWRRIKDFPYDGPLHESGIFVSGTVNWLAIDN 247 Query: 42 -AASSSWPVIVSLDL 1 +++SS IVSLDL Sbjct: 248 SSSNSSLRAIVSLDL 262 >XP_013467788.1 F-box protein interaction domain protein [Medicago truncatula] KEH41825.1 F-box protein interaction domain protein [Medicago truncatula] Length = 393 Score = 68.6 bits (166), Expect = 6e-12 Identities = 39/80 (48%), Positives = 51/80 (63%), Gaps = 9/80 (11%) Frame = -1 Query: 213 YKVVAVFCLD-QYVRD-----KTQVCIYTLGTDSWRTIQEYPYHAL---GDRAGIFVSGT 61 YK+V+VFC D QYV + KTQV ++TLGTDSWR I ++P + + +GI VSGT Sbjct: 213 YKIVSVFCYDSQYVGNRMKSCKTQVQVHTLGTDSWRRISDFPSTMVPRGRNESGIIVSGT 272 Query: 60 VNWLAFAASSSWPVIVSLDL 1 VNW ++ S IVS DL Sbjct: 273 VNWFVYSIVSPRRAIVSFDL 292 >XP_013458776.1 F-box protein interaction domain protein [Medicago truncatula] KEH32808.1 F-box protein interaction domain protein [Medicago truncatula] Length = 399 Score = 68.6 bits (166), Expect = 6e-12 Identities = 38/72 (52%), Positives = 48/72 (66%), Gaps = 1/72 (1%) Frame = -1 Query: 213 YKVVAVFCLDQYVRDKT-QVCIYTLGTDSWRTIQEYPYHALGDRAGIFVSGTVNWLAFAA 37 YK+VAV + DK+ +V +YTLGTDSWR IQ+ PY+ G+F GT+NWLA + Sbjct: 205 YKIVAV----SFFYDKSYEVLVYTLGTDSWRRIQDLPYYGYISEPGVFARGTINWLAHES 260 Query: 36 SSSWPVIVSLDL 1 SSS IVSLDL Sbjct: 261 SSSHN-IVSLDL 271 >XP_013459073.1 F-box protein interaction domain protein [Medicago truncatula] KEH33126.1 F-box protein interaction domain protein [Medicago truncatula] Length = 450 Score = 68.2 bits (165), Expect = 9e-12 Identities = 33/71 (46%), Positives = 49/71 (69%) Frame = -1 Query: 213 YKVVAVFCLDQYVRDKTQVCIYTLGTDSWRTIQEYPYHALGDRAGIFVSGTVNWLAFAAS 34 YK++A+ + +K + +YTLGTDSWR IQ++P+ +L +G+FVSG VNWL + Sbjct: 253 YKIIAI----SFFNEKYETRVYTLGTDSWRKIQDFPHLSLYHPSGVFVSGAVNWLVYDGF 308 Query: 33 SSWPVIVSLDL 1 S+ +IVSLDL Sbjct: 309 RSF-IIVSLDL 318 >XP_019420066.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like [Lupinus angustifolius] OIV95875.1 hypothetical protein TanjilG_06851 [Lupinus angustifolius] Length = 367 Score = 67.8 bits (164), Expect = 1e-11 Identities = 40/78 (51%), Positives = 50/78 (64%), Gaps = 7/78 (8%) Frame = -1 Query: 213 YKVVAVFCLD----QYVRDKTQVCIYTLGTDSWRTIQEYPYHALGDRAGIFVSGTVNWLA 46 YKVV VFC + + +T+V ++TLGTD WR IQE+P D +G FV G +NWLA Sbjct: 164 YKVVGVFCYECGSGGAIAYRTEVKVHTLGTDYWRRIQEFPSGVPFDSSGKFVCGAINWLA 223 Query: 45 F---AASSSWPVIVSLDL 1 A +SSW VIVSLDL Sbjct: 224 SGSDAFNSSW-VIVSLDL 240 >XP_004486107.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like [Cicer arietinum] Length = 405 Score = 67.4 bits (163), Expect = 2e-11 Identities = 41/79 (51%), Positives = 50/79 (63%), Gaps = 8/79 (10%) Frame = -1 Query: 213 YKVVAVFCLDQYVRD-------KTQVCIYTLGTDSWRTIQEYPYHALGDRAGIFVSGTVN 55 YKVVAV C + KT+V ++TLGT+SWR IQ++P D +G FV+GTVN Sbjct: 199 YKVVAVSCYESDTNGSTSNRVYKTEVKVHTLGTNSWRRIQDFPSGVPFDESGKFVNGTVN 258 Query: 54 WLAFAA-SSSWPVIVSLDL 1 WLA SSW VIVSLDL Sbjct: 259 WLASTDWISSW-VIVSLDL 276 >XP_013470399.1 F-box protein interaction domain protein [Medicago truncatula] KEH44437.1 F-box protein interaction domain protein [Medicago truncatula] Length = 371 Score = 66.6 bits (161), Expect = 3e-11 Identities = 36/71 (50%), Positives = 46/71 (64%) Frame = -1 Query: 213 YKVVAVFCLDQYVRDKTQVCIYTLGTDSWRTIQEYPYHALGDRAGIFVSGTVNWLAFAAS 34 YK++AV D +K +V I+ LGTD WR IQ+ PY+ + R G FVS TVNWL + S Sbjct: 169 YKIIAVI-FDS--NNKNEVNIHALGTDYWRKIQDLPYNKIHRRPGTFVSDTVNWLVYDRS 225 Query: 33 SSWPVIVSLDL 1 + VIVSLDL Sbjct: 226 RATKVIVSLDL 236 >GAU20086.1 hypothetical protein TSUD_381780 [Trifolium subterraneum] Length = 406 Score = 66.6 bits (161), Expect = 3e-11 Identities = 38/74 (51%), Positives = 49/74 (66%), Gaps = 3/74 (4%) Frame = -1 Query: 213 YKVVAVFCLDQYVRD---KTQVCIYTLGTDSWRTIQEYPYHALGDRAGIFVSGTVNWLAF 43 YKVVAV C + + KT V ++TLGT+SWR I+++P D +G FVSGT+NWLA Sbjct: 206 YKVVAVNCYESESDNRVYKTNVKVHTLGTNSWRWIEDFPSGVPFDFSGRFVSGTINWLAA 265 Query: 42 AASSSWPVIVSLDL 1 S + VIVSLDL Sbjct: 266 KDSYTSLVIVSLDL 279 >GAU20090.1 hypothetical protein TSUD_381820 [Trifolium subterraneum] Length = 439 Score = 66.2 bits (160), Expect = 4e-11 Identities = 41/82 (50%), Positives = 47/82 (57%), Gaps = 11/82 (13%) Frame = -1 Query: 213 YKVVAVFCLDQYVRD-----------KTQVCIYTLGTDSWRTIQEYPYHALGDRAGIFVS 67 YKVVAV D+Y D +TQV +YTLGT SWR IQ+ PY L + FVS Sbjct: 221 YKVVAVNHYDEYDSDVIDGSDFHVITRTQVKVYTLGTSSWRIIQDCPYGILYGDSVTFVS 280 Query: 66 GTVNWLAFAASSSWPVIVSLDL 1 GTVNW S+ VIVSLDL Sbjct: 281 GTVNWWVTNDSNISEVIVSLDL 302 >XP_003599216.1 F-box protein interaction domain protein [Medicago truncatula] AES69467.1 F-box protein interaction domain protein [Medicago truncatula] Length = 393 Score = 65.9 bits (159), Expect = 6e-11 Identities = 36/72 (50%), Positives = 46/72 (63%), Gaps = 1/72 (1%) Frame = -1 Query: 213 YKVVAVFCLDQYVRDKT-QVCIYTLGTDSWRTIQEYPYHALGDRAGIFVSGTVNWLAFAA 37 YK+V V + DK+ +VC YTLGTD WR IQ+ PY + G+F GT+NWLA+ + Sbjct: 187 YKIVGV----SFFPDKSNEVCCYTLGTDCWRRIQDLPYGST-SAVGVFARGTINWLAYDS 241 Query: 36 SSSWPVIVSLDL 1 SS IVSLDL Sbjct: 242 QSSSHNIVSLDL 253 >XP_013470353.1 F-box protein interaction domain protein [Medicago truncatula] KEH44391.1 F-box protein interaction domain protein [Medicago truncatula] Length = 378 Score = 65.5 bits (158), Expect = 8e-11 Identities = 36/72 (50%), Positives = 48/72 (66%), Gaps = 1/72 (1%) Frame = -1 Query: 213 YKVVAVFCLDQYVRDKTQVCIYTLGTDSWRTIQEYPYHALG-DRAGIFVSGTVNWLAFAA 37 YK++A L Y+ +K++V ++TLGTD WR I ++P H+L GIFVS TVNWL + Sbjct: 181 YKIIA---LTLYLNNKSEVNVHTLGTDYWRKIDDFPCHSLACISPGIFVSDTVNWLLYDN 237 Query: 36 SSSWPVIVSLDL 1 S VIVSLDL Sbjct: 238 CSYSMVIVSLDL 249