BLASTX nr result
ID: Glycyrrhiza32_contig00016253
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00016253 (303 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013442839.1 hypothetical protein MTR_0082s0250 [Medicago trun... 72 1e-14 GAU19192.1 hypothetical protein TSUD_198740 [Trifolium subterran... 72 2e-13 >XP_013442839.1 hypothetical protein MTR_0082s0250 [Medicago truncatula] KEH16864.1 hypothetical protein MTR_0082s0250 [Medicago truncatula] Length = 96 Score = 72.4 bits (176), Expect = 1e-14 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -1 Query: 108 MTLSNRYRFADDVVKESTPLCTRIGSLYGWTEGLSQ 1 MTLSNR RFADDVVKESTPLCTRI SLYGWTEGLSQ Sbjct: 1 MTLSNRSRFADDVVKESTPLCTRISSLYGWTEGLSQ 36 >GAU19192.1 hypothetical protein TSUD_198740 [Trifolium subterraneum] Length = 210 Score = 72.4 bits (176), Expect = 2e-13 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -1 Query: 108 MTLSNRYRFADDVVKESTPLCTRIGSLYGWTEGLSQ 1 MTLSNR RFADDVVKESTPLCTRI SLYGWTEGLSQ Sbjct: 1 MTLSNRSRFADDVVKESTPLCTRISSLYGWTEGLSQ 36