BLASTX nr result
ID: Glycyrrhiza32_contig00016069
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00016069 (319 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003546411.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 5e-06 XP_003533718.1 PREDICTED: pentatricopeptide repeat-containing pr... 53 9e-06 GAU39069.1 hypothetical protein TSUD_321400 [Trifolium subterran... 53 9e-06 >XP_003546411.1 PREDICTED: pentatricopeptide repeat-containing protein At2g18940, chloroplastic-like [Glycine max] KHN15350.1 Pentatricopeptide repeat-containing protein [Glycine soja] KRH12254.1 hypothetical protein GLYMA_15G162500 [Glycine max] Length = 829 Score = 53.5 bits (127), Expect = 5e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = +1 Query: 208 MEGTLFPNRPLLPVPANKPTQTTTQSLKFKPTLFSP 315 MEGTLFPNRP+LP P++KPTQ Q LKFKPT P Sbjct: 1 MEGTLFPNRPVLPAPSHKPTQ---QPLKFKPTFLPP 33 >XP_003533718.1 PREDICTED: pentatricopeptide repeat-containing protein At2g18940, chloroplastic-like [Glycine max] KRH37281.1 hypothetical protein GLYMA_09G056200 [Glycine max] Length = 830 Score = 52.8 bits (125), Expect = 9e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = +1 Query: 208 MEGTLFPNRPLLPVPANKPTQTTTQSLKFKPTLFSP 315 MEGTLFPNRP+LPVP++KPTQ LKFKPT P Sbjct: 1 MEGTLFPNRPVLPVPSHKPTQ---PPLKFKPTFLPP 33 >GAU39069.1 hypothetical protein TSUD_321400 [Trifolium subterraneum] Length = 843 Score = 52.8 bits (125), Expect = 9e-06 Identities = 27/38 (71%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Frame = +1 Query: 208 MEGTLFPNRPLLPVPANKPTQTTTQSLKFKPTL-FSPP 318 MEGTLFPNRP+LP+P KPTQT LKFKPT SPP Sbjct: 1 MEGTLFPNRPVLPLPTKKPTQT----LKFKPTFSHSPP 34